MarkosWeb

covid-19 widget

Virtuozzo websites probably the best selection from 63 total domains

Visitors who searched Virtuozzo also search  plesk,  vps,  web hosting

Virtualization.info Favicon Virtualization.info - virtualization.info News digest about virtualization technologies products market trends. Since 2003

News digest about virtualization technologies products market trends. Since 2003

Tagged as: daily news, virtual server, vmware. See more tags (16) at virtualization.info page.

http://virtualization.info/en/

4psa.com Favicon 4psa.com - 4PSA - Cloud Calling

Software for hosting companies VoIP Control Panel VoipNow Plesk and Virtuozzo extensions dns management tools The leading hosted Unified Communications System the next generation PBX system

Tagged as: software solutions, voip, internet service. See more tags (20) at 4psa.com page.

http://www.4psa.com/

Fluidhosting.com - Fluid Hosting Linux and Windows Hosting

Reliable Web hosting services

Tagged as: web hosting, hosting, website hosting. See more tags (24) at fluidhosting.com page.

http://fluidhosting.com

Demodemo.com Favicon Demodemo.com - DemoWolf - Flash Tutorials for Hosting Companies

Tagged as: web hosting, wordpress, email. See more tags (27) at demodemo.com page.

http://demodemo.com

Vinacis.com Favicon Vinacis.com - VinaCIS We do IT for you

VINH NAM - VinaCIS Corporation

Tagged as: web hosting, server hosting, onlinevideos. See more tags (14) at vinacis.com page.

http://vinacis.com

In2net.com - Colocation Cloud Hosting Dedicated Servers and Fiber Connections - In2net Network

Quality and affordable Colocation Dedicated and VPS hosting solutions from In2net Network Inc

Tagged as: service provider, server, dedicated servers. See more tags (13) at in2net.com page.

http://in2net.com

Linuxsever.com Favicon Linuxsever.com - Trkiye'nin Linux platformu

linuxcentosdebianfedoraredhatunixfreebsdopenbsdcpanelwhmdirectadminparallelspleskhyperwmvirtuozzowmwareapachelitespeedmysqlnetworkgvenliksecuritykabuk programlamaduyurularnerilerinizkonu dgeri dnm kutusu

Tagged as: mysql, linux, security. See more tags (23) at linuxsever.com page.

http://www.linuxsever.com/forum/portal.php

Nano.lv Favicon Nano.lv - Hosting domain name registration virtual private servers colocation in data center Nano.lv

Hosting domain name registration virtual servers colocation in Latvia. Datacenter. Low prices unlimited traffic

Tagged as: typo3hosting, softwaredevelopmentoutsourcing, vmware. See more tags (4) at nano.lv page.

http://www.nano.lv/

Sharktech.net Favicon Sharktech.net - Server Hosting DDoS Firewall Protection & Managed Services

Do you need Server Hosting DDoS Firewall protection and Managed Services at affordable rates Contact SharkTECH Internet Security Now

Tagged as: internet services, dedicated servers, affordable prices. See more tags (19) at sharktech.net page.

http://sharktech.net

Dutchwebhosting.nl Favicon Dutchwebhosting.nl - Webhost Webhosting en domeinregistratie dutchwebhosting.nl

Dutchwebhosting Solutions de betrouwbare voordelige en meest complete webhost in Europa voor hosting webhosting domeinnaam registratie vps

Tagged as: web hosting, hosting, server. See more tags (22) at dutchwebhosting.nl page.

http://dutchwebhosting.nl/nl/

Virtuo.it Favicon Virtuo.it - VIRTUO - NGI SpA

Tagged as: hosting, shop, server. See more tags (14) at virtuo.it page.

http://www.ngi.it/it/servizi/virtuo/

Veriportal.com Favicon Veriportal.com - VeriPortal DataCenter Veri Merkezi Ankara - VeriTeknik - Sunucu Kiralama Server Barndrma Exchange ve Bayi Hosting - VeriPortal DataCenter Ankara - Kiralk Sunucu - Sunucu Barndrma...

VeriPortal DataCenter sunucu kiralama sunucu barndrma ve bayi hosting hizmetleri - VeriTeknik Biliim Ltd. & VeriTeknik Telekom Ltd. Ankara

Tagged as: hosting, windows, domain. See more tags (22) at veriportal.com page.

http://veriportal.com

Sanallastirma.net Favicon Sanallastirma.net - Sanallatrma zmleri

Tagged as: windows server, server 2008, windows server 2008. See more tags (12) at sanallastirma.net page.

http://www.sanallastirma.net/

Simplyroot.de Favicon Simplyroot.de - www.simplyroot.de - simply keep it simple

Vserver Genießen Sie vollen root Zugriff auf Ihrem Server! Seien Sie frei in der Konfiguration Ihres Servers und erhalten dabei dennoch die Leichtigkeit von Shared Webhosting

Tagged as: linux, server, domains. See more tags (24) at simplyroot.de page.

http://www.simplyroot.de/

Ibericahost.com Favicon Ibericahost.com - Ibericahost SpainHost Hosting Alojamiento Web Dominios SpainRadio Servidores Tiendas SSL Gaming

El mejor servicio de internet de las Baleares

Tagged as: en internet, streaming, adsl. See more tags (9) at ibericahost.com page.

http://ibericahost.com

Idaq.com Favicon Idaq.com - iDAQ - Uk Based web hosting virtual & dedicated server hosting

Idaq offers personal & business web hosting dedicated servers domain name registration virtual servers & SSL certificates in our very own UK based Datacentre

Tagged as: web hosting, hosting, domain names. See more tags (20) at idaq.com page.

http://idaq.com

Malaysiavm.com Favicon Malaysiavm.com - Malaysia VMware Communities

Malaysia VMware Communities Malaysia VMware User Group VMware Malaysia Malaysia VMware Forum Virtualization Malaysia Malaysia Virtualization

Tagged as: forum, tips, green. See more tags (15) at malaysiavm.com page.

http://malaysiavm.com/blog/

Sl.ru Favicon Sl.ru

root vps

http://sl.ru/

Rack.ro - Rack.ro - Servere Virtuale Private VPS pachete de gazduire inregistrare domenii software pentru administrarea serverelor

Servere Virtuale Private VPS pachete de gazduire inregistrare domenii software pentru administrarea serverelor consultanta n probleme de securitate solutii VoIP sisteme de operare solutii VPN proiectare si ntretinere de retele servere si cl...

Tagged as: software, hosting, domain registration. See more tags (12) at rack.ro page.

http://rack.ro

Flexservers.com Favicon Flexservers.com - Virtual and dedicated servers - Flexservers

High performance dedicated servers - Linux CentOS 5 or Debian 5.0 Data traffic available immediately Plesk 8 included

Tagged as: web server, dedicated servers, dedicated server. See more tags (16) at flexservers.com page.

http://www.flexservers.com/

Vpsdeal.com - Nice Virtual Private Server VPS deals discount and promo promotional code

VPS deals discounts and promotional codes - informations about Virtual Private Servers

Tagged as: hosting, windows, linux. See more tags (15) at vpsdeal.com page.

http://vpsdeal.com

Tqhosting.com Favicon Tqhosting.com - Web Hosting - Raleigh NC & Dallas TX Tranquil Hosting

We know how important it is to have reliable & knowledgeable people there when you need them. Find out more!

Tagged as: service provider, dedicated servers, linux hosting. See more tags (20) at tqhosting.com page.

http://www.tqhosting.com/

Fido.net Favicon Fido.net - FidoNet - Business Broadband Web Hosting & Domain Names

FidoNet provides Broadband & Web Hosting for small businesses & individuals. Whether you're looking for connectivity a domain or a complete web hosting solution FidoNet's got it!

Tagged as: web hosting, free domain, control panel. See more tags (27) at fido.net page.

http://fido.net

Hostsave.com Favicon Hostsave.com - Web Hosting Domain Names Virtual Private Servers Gate.com

Gate is a leading provider of web hosting domain names exchange hosting and virtual private servers

Tagged as: web hosting, domain names, domainname registration. See more tags (19) at hostsave.com page.

http://hostsave.com/

Serverex.net Favicon Serverex.net - Serverex.Net VPS VDS . VPS VDS Direct Admin. VPS

Tagged as: apache, cpanel, dedicated. See more tags (7) at serverex.net page.

http://serverex.net

Hostingamerica.com Favicon Hostingamerica.com - Dell Dedicated Servers From Only $59.99mo with 1200GB Transfer From Our Own SAS-70 Certified Tier-3 Data Centers

HostingAmerica.com Dell Dedicated Servers Starting at Only $59.99mo with 1200 GB transfer. From Our Own Tier 3 SAS-70 Type II Certified Data Centers

Tagged as: website hosting, linux, dedicated servers. See more tags (20) at hostingamerica.com page.

http://hostingamerica.com

Vmtimes.com - VM Times

Virtualization news and reviews

Tagged as: blog, microsoft, application development. See more tags (15) at vmtimes.com page.

http://vmtimes.com

Whatcomhost.com - Business Web Hosting Bellingham Web Hosting Small Business Web Hosting Virtuozzo Plesk Control Panels - Whatcom Host

Whatcom Host - Business Web Hosting Bellingham Web Hosting Small Business Web Hosting Whatcom Web Hosting Virtuozzo Plesk

Tagged as: web hosting, small business, business web. See more tags (15) at whatcomhost.com page.

http://whatcomhost.com/

Thenamegame.com - Portal Home - eFastServers

Tagged as: web hosting, webhosting, reseller hosting. See more tags (22) at thenamegame.com page.

http://efastservers.net/manage/

Portland.nl Favicon Portland.nl - Home - Portland Europe

Tagged as: portland, signos de puntuacin, mcafee. See more tags (7) at portland.nl page.

http://www.portland.nl/nl

Conetix.com.au - Australian Premier Web Hosting Conetix

Business grade Australian web and application solutions

Tagged as: webdesign, web hosting, online. See more tags (27) at conetix.com.au page.

http://www.conetix.com.au/

Ultrasitios.com Favicon Ultrasitios.com - Web hosting Profesional - Dedicados - dominios - cpanel en espaol!

web hosting en Argenina Servidores dedicados en Espaa VPS en mxico

Tagged as: web hosting, internet, hosting. See more tags (19) at ultrasitios.com page.

http://ultrasitios.com

My-simplyroot.de Favicon My-simplyroot.de - www.simplyroot.de - simply keep it simple

Vserver Genießen Sie vollen root Zugriff auf Ihrem Server! Seien Sie frei in der Konfiguration Ihres Servers und erhalten dabei dennoch die Leichtigkeit von Shared Webhosting

Tagged as: linux, server, domains. See more tags (22) at my-simplyroot.de page.

http://www.simplyroot.de/de/vserver/

Vpsdiscussions.com - SEO

Tagged as: web hosting, vps hosting, hosting solutions. See more tags (18) at vpsdiscussions.com page.

http://vpsdiscussions.com

I-s-e.nl Favicon I-s-e.nl - Welkom op Internet Service Europe BV. - I.S.E. BV

Internet Service Europe BV is een professioneel webhostingbedrijf met diverse dochterondernemingen

Tagged as: hosting, webhosting, internet service. See more tags (12) at i-s-e.nl page.

http://i-s-e.nl

Atelra.com Favicon Atelra.com - HugeDomains.com - Shop for over 300000 Premium Domains

Tagged as: webdesign, web hosting, hosting. See more tags (16) at atelra.com page.

http://www.hugedomains.com/domain_profile.cfm?d=atelra&e=com

Kurdd.com

Tagged as: webdesign, web hosting, internet. See more tags (28) at kurdd.com page.

http://www.kurdd.com/vb/

Pchardweb.com - Rack.ro - Servere Virtuale Private VPS pachete de gazduire inregistrare domenii software pentru administrarea serverelor

Servere Virtuale Private VPS pachete de gazduire inregistrare domenii software pentru administrarea serverelor consultanta n probleme de securitate solutii VoIP sisteme de operare solutii VPN proiectare si ntretinere de retele servere si cl...

Tagged as: software, hosting, domain registration. See more tags (10) at pchardweb.com page.

http://pchardweb.com

Gate.com Favicon Gate.com - Web Hosting Domain Names Virtual Private Servers Gate.com

Gate is a leading provider of web hosting domain names exchange hosting and virtual private servers

Tagged as: web hosting, domain names, domainname registration. See more tags (21) at gate.com page.

http://www.gate.com/

A2b2.net - VPS Virtual servers Unmanaged VPS OpenVZ XEN ZEN KVM - UK

Unmanaged VPS hosting at a low cost with 247 technical support. Choice of 3 VPS platforms - OpenVZ Xen and KVM SolusVM control panel unlimited OS reloads and reboots. cPanel Direct Admin remote backups redundant DNS and more available

Tagged as: hosting, shortfilm, xen hosting. See more tags (6) at a2b2.net page.

http://www.cheapvps.co.uk

Rootforum.org Favicon Rootforum.org - Resources for System-Administrators RootForum Community

Wir bieten HowTos und andere ntzliche Informationen rund um die Administration von FreeBSD und Linux basierten Servern RootServer

Tagged as: forum, community, mysql. See more tags (30) at rootforum.org page.

http://www.rootforum.org

Transworks.kz - TransWorks - IT Consulting & System Integration IT

Tagged as: windows, linux, network. See more tags (21) at transworks.kz page.

http://transworks.kz/

Support.dutchwebhosting.nl Favicon Support.dutchwebhosting.nl - Support

DutchwebHosting Solutions de betrouwbare voordelige en meest complete hostprovider in Europa voor hosting webhosting vps dedicated server linux unix 14 jaar eenzaam aan de top

Tagged as: hosting, shopping cart, ecommerce. See more tags (28) at support.dutchwebhosting.nl page.

http://dutchwebhosting.nl/nl/support.html

Sec4ever.com - Sec4ever

Tagged as: e books, designer, internet services. See more tags (30) at sec4ever.com page.

http://sec4ever.com/

Bitmovers.it - Bitmovers srl - Home

Tagged as: internet, email, email marketing. See more tags (24) at bitmovers.it page.

http://www.bitmovers.it/

Pingvps.com - Index of

Tagged as: web hosting, hosting, windows. See more tags (24) at pingvps.com page.

http://pingvps.com/

Cyberdine.ch - Willkommen auf der Startseite

Webdienstleistungen und Service sowie Webhosting seit 1996. Wir bieten VHosts VServer sowie SPAMVirus Gateway Lsungen genau massgeschneidert fr Ihre Anforderungen

Tagged as: hosting, webhosting, antivirus. See more tags (15) at cyberdine.ch page.

http://cyberdine.ch/

Root-host.pro - a. Root-host.pro

Root-host.pro

Tagged as: mysql, windows, linux. See more tags (8) at root-host.pro page.

http://root-host.pro

What people search with virtuozzo:

more...