MarkosWeb

covid-19 widget

Server websites probably the best selection from 8,838 total domains

Visitors who searched Server also search  hosting,  domain,  web hosting

Dell.com - Dell Official Site - The Power To Do More Dell

Dell provides technology solutions services and support. Visit Dell.com for Laptops Netbooks Tablet PCs Desktops Monitors Servers Storage Mobile Phones Printers and Computer Accessories

Tagged as: sales, homepage, computers. See more tags (29) at dell.com page.

http://www.dell.com/

Hp.com - HP Official Site Laptop Computers Desktops Printers Servers Services and more

Learn about HP printers laptops desktops storage solutions cloud solutions servers enterprise services solutions and more at the Official HP Website

Tagged as: software, networking, computers. See more tags (27) at hp.com page.

http://www.hp.com/

1und1.de - 1&1 Internet AG - DSL Hosting Mobile Internet Domain Server

DSL- und Handy-Flatrates - Webhosting fr Einsteiger Profis!

Tagged as: hosting, domain, mobile internet. See more tags (10) at 1und1.de page.

http://www.1und1.de/

Sun.com - Oracle and Sun Microsystems Strategic Acquisitions Oracle

Since Oracle acquired Sun in 2010 Oracle's hardware and software engineers have worked side-by-side to build fully integrated systems and optimized solutions

Tagged as: software, service, training. See more tags (29) at sun.com page.

http://www.oracle.com/us/sun/index.htm

Sharebee.com - Sharebee.com the one and only online file hosting distribution service

Sharebee.com the one and only online file upload distribution service. To help you keep your shared files online using several different file hosting web hosting providers

Tagged as: web hosting, hosting, storage. See more tags (20) at sharebee.com page.

http://www.sharebee.com/

Strato.de - Hosting Online-Speicher Webshop & Server - STRATO

Hosting-Pakete Online-Speicher Homepage Webshops u. Server von STRATO. Professionelle Lsungen fr Einsteiger & Profis. berzeugen Sie sich selbst!

Tagged as: blog, hosting, website. See more tags (24) at strato.de page.

http://www.strato.de/

Bhinneka.com - Bhinneka.Com Toko Online Komputer Gadget Fotografi Elektronik Musik dan banyak lagi

Toko Online No. 1 dan Terbesar di Indonesia dengan produk LENGKAP Kualitas TERJAMIN Harga MURAH CICILAN 0% dan GRATIS Pengiriman

Tagged as: review, laptop, desktop. See more tags (14) at bhinneka.com page.

http://www.bhinneka.com/aspx/bhindexpc.aspx

Phpbuilder.com - PHP Developers Sharing Knowledge Since 1999 PHPBuilder.com

PHP Developers Sharing Knowledge Since 1999

Tagged as: e commerce, flash, mysql. See more tags (23) at phpbuilder.com page.

http://www.phpbuilder.com/

Vis.ne.jp

http://vis.ne.jp

Msi.com.tw - MSI Global - Computer Laptop Notebook Desktop Mainboard Graphics and more

Welcome to the MSI Global website. MSI designs and creates Mainboard AIO Graphics card Notebook Netbook Tablet PC Consumer electronics Communication Barebone Server industrial computing Multimedia Clean Machine and Car Infotainment

Tagged as: communication, healthcare, notebook. See more tags (23) at msi.com.tw page.

http://www.msi.com/language/

Worldtimeserver.com - World Time Server current local time and date in any zone

World Time Server shows current local time and date in cities and countries in all time zones adjusted for Daylight Saving Time rules automatically

Tagged as: news, international, database. See more tags (26) at worldtimeserver.com page.

http://www.worldtimeserver.com/

Rev6.com - Rev6.com - The 6th Revolution

The 6th revolution bring you a Silkroad Online mmorpg Datamining website. Ladder player stats guild stats character builder mmorpg tutorial and more

Tagged as: online, game, europe. See more tags (20) at rev6.com page.

http://www.rev6.com/

Knowsky.com - www.knowsky.com

jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop

Tagged as: mysql, linux, java. See more tags (10) at knowsky.com page.

http://knowsky.com/

Register.it - Internet domain name registration at Register.it Domain hosting

Register.it offers internet domain registration renewals and domain name transfers. With every domain free web hosting webmail and unlimited disk space

Tagged as: domain name, web hosting, domain. See more tags (19) at register.it page.

http://we.register.it/

Otservlist.org - otservlist.org - Open Tibia Server

Tagged as: googlereader, server list, tibia. See more tags (8) at otservlist.org page.

http://otservlist.org/

Wieistmeineip.de - Wie ist meine IP-Adresse

So knnen Sie herausfinden mit welcher IP-Adresse Sie online sind

Tagged as: proxy, iletim, client. See more tags (9) at wieistmeineip.de page.

http://www.wieistmeineip.de/

Server4you.de - Dedicated Server vServer Server4You

Dedicated Server und vServer mit dem besten Preis-Leistungs-Verhltnis Server4You. Schnelle Anbindung Top-Support Spitzenhardware!

Tagged as: internet, software, hosting. See more tags (26) at server4you.de page.

http://www.server4you.de/

Foxitsoftware.com - PDF Converter PDF Editor Edit and Convert PDF Word files to PDF Free PDF convert save PDF forms create PDF forms pdf documents protect pdf

Quickly convert jpg html and office files word powerpoint excel to pdf with foxit pdf converter. Easily edit pdf files with Foxit pdf editor which is better than acrobat pdf editor. Try it now for free

Tagged as: software, windows, access. See more tags (24) at foxitsoftware.com page.

http://foxitsoftware.com/

Kingston.com - SD Cards SSDs Memory Modules and USB Flash Drives - Kingston

Reliable SD cards SSD drives memory modules and USB flash drives for consumers businesses enterprises and system builders offered by Kingston Technology

Tagged as: flash, media, servers. See more tags (26) at kingston.com page.

http://www.kingston.com/us/

Freesoft-board.to - Freesoft-Board

Freesoft-Board eines der grossen Diskussionsforen Deutschlands!

Tagged as: software, games, hardware. See more tags (18) at freesoft-board.to page.

http://www.freesoft-board.to/

1blu.de - Webhosting Webspace und Homepagelsungen von 1blu

Die Berliner 1blu AG bietet modernes und preiswertes Webhosting fr professionelle Internetprsenzen. Geschftskunden Profis und private Anwender erhalten bei 1blu leistungsstarke Webhosting-Pakete virtuelle Server dedizierte Server und eShops...

Tagged as: web hosting, software, hosting. See more tags (26) at 1blu.de page.

http://www.1blu.de/

Oneandone.co.uk - 1and1.co.uk - Domain Hosting and website solutions

1&1 offers domain names website tools and hosting packages for your business. Benefit from our 247 customer support

Tagged as: domain name, web hosting, hosting. See more tags (18) at oneandone.co.uk page.

http://www.1and1.co.uk/

Astraweb.com - news.astraweb.com - Usenet News Server - $10month

Premium Unlimited Usenet news server services

Tagged as: news, coloriageenfantsgratuit, unlimited. See more tags (6) at astraweb.com page.

http://astraweb.com/

Forumpcs.com.br - FORUM PCs - Tecnologia e Informao

Tagged as: windows, iphone, digital. See more tags (28) at forumpcs.com.br page.

http://forumpcs.com.br/

Ozzu.com - Ozzu - Webmaster Forums Headlines Web Design Programming

Webmaster forums headlines tutorials and information and resources for a professional webmaster designer programmer and developer

Tagged as: design, website design, hosting. See more tags (22) at ozzu.com page.

http://www.ozzu.com/

Czshare.com - CZshare

download CZshare

Tagged as: data, upload, iletim. See more tags (7) at czshare.com page.

http://czshare.com/

Ezzi.net - Dedicated Servers Cloud Servers Virtual Servers

Get Dedicated Server Dedicated Windows Linux Servers Hosting & Cloud Server Hosting Services 100% Network Uptime Guarantee. 247 Technical Support

Tagged as: web hosting, internet, hosting. See more tags (27) at ezzi.net page.

http://www.ezzi.net/

1und1.info - Webhosting von 1&1

1&1 Webhosting fr Linux oder Windows mit PHP Unlimited Traffic Georedundanz fr Einsteiger und Profis inclusive Domain

Tagged as: hosting, website, shop. See more tags (16) at 1und1.info page.

http://hosting.1und1.de/

Dell.com.cn - Dell - Dell

DellDellDell

Tagged as: laptop, notebook, desktop. See more tags (6) at dell.com.cn page.

http://dell.com.cn/

Lima-city.de - Kostenloser unbegrenzter Webspace von lima-city

Wir bieten dir kostenlos unbegrenzten werbefreien Webspace ohne Traffic-Limit mit PHP FTP MySQL-Datenbanken E-Mail-Versand Downloads und IPv6. Free!

Tagged as: design, software, forum. See more tags (19) at lima-city.de page.

http://www.lima-city.de/

Cdw.com - CDW - Computers Hardware Software and IT Solutions for Business

The information technology products expertise and service you need to make your business successful. Fast shipping fast answers the industry's largest in-stock inventories custom configurations and more

Tagged as: products and services, information technology, computers. See more tags (27) at cdw.com page.

http://www.cdw.com/

Dreamhost.com - Web Hosting Domains VPS Dedicated and WordPress Hosting - DreamHost

DreamHost is the leader in shared web hosting vps hosting dedicated hosting WordPress hosting cloud storage and cloud computing. Try us for Free today

Tagged as: web hosting, ecommerce, mysql. See more tags (25) at dreamhost.com page.

http://www.dreamhost.com/

Filezilla-project.org - FileZilla - The free FTP solution

Tagged as: open source, client, kredi kart. See more tags (6) at filezilla-project.org page.

http://filezilla-project.org/

2ip.ru - IP

IP

Tagged as: voip, firewall, proxy. See more tags (8) at 2ip.ru page.

http://2ip.ru/

Dbforums.com - dBforums - Database Support Community

dBforums is a discussion forum and helpdesk for database design development and administration issues. To visit the forum go to httpdbforums.com

Tagged as: forum, mysql, database. See more tags (21) at dbforums.com page.

http://www.dbforums.com/

Runelocus.com - RuneScape Private Servers RSPS - RuneLocus

The most popular community and resource for RuneScape private server. We provide you with the best RSPS item lists downloads tutorials and more

Tagged as: web development, the game, programming. See more tags (25) at runelocus.com page.

http://www.runelocus.com/

Teamspeak.com - TeamSpeak - Welcome to TeamSpeak

Tagged as: blog, internet, forum. See more tags (25) at teamspeak.com page.

http://teamspeak.com/

Highmetrics.com - HighMetrics Smart Tracker & AdServer Solutions

HighMetrics - Site-centric Tracking and AdServing solutions

Tagged as: advertising, site, tracking. See more tags (13) at highmetrics.com page.

http://www.highmetrics.com/

All-inkl.com - Domains Webspace Domain Webhosting Server-Hosting Provider ALL-INKL

Führender Webhost & Provider für Domains Homepage-Webspace Domain-Webhosting & Server Server-Hosting Managed Server. ALL-INKL - für Retail & Reseller!

Tagged as: hosting, webhosting, domains. See more tags (13) at all-inkl.com page.

http://all-inkl.com

Server4free.de - Dedicated Server vServer Server4You

Dedicated Server und vServer mit dem besten Preis-Leistungs-Verhltnis Server4You. Schnelle Anbindung Top-Support Spitzenhardware!

Tagged as: internet, software, hosting. See more tags (25) at server4free.de page.

http://www.server4you.de/

Net2ftp.com - net2ftp - a web based FTP client

net2ftp is a web based FTP client. It is mainly aimed at managing websites using a browser. Edit code uploaddownload files copymovedelete directories recursively rename files and directories -- without installing any software

Tagged as: hosting, web based, host. See more tags (20) at net2ftp.com page.

http://net2ftp.com/

Samair.ru - SamAir Security Home Page

We offer Free Proxy Lists SOCKS Lists Premium paid proxy services for you privacy

Tagged as: security, list, proxy. See more tags (11) at samair.ru page.

http://samair.ru/

Evanzo.de - EVANZO Hosting

EVANZO Domain Email Webhosting Linux Windows Servers HostedServices

Tagged as: windows, domain, linux. See more tags (16) at evanzo.de page.

http://evanzo.de/

Keymachine.de - Markenserver von der Keyweb AG

Keyweb AG ist ein Provider und Hoster der Ihnen Server zu unschlagbaren Preisen Webspace Speicherplatz ein Partnerprogramm den kompletten Domainservice bis zur Domainregistrierung und Rabatte fr Reseller und Wiederverkufer einrumt

Tagged as: design, internet, hosting. See more tags (18) at keymachine.de page.

http://keyweb.de/

Silicon.de - silicon.de - Technologie- und Business-Nachrichten silicon.de

silicon.de ist das Informationsnetzwerk fr Technologie und Business. Tagesaktuelle News fr CIOs IT-Leiter und IT-Entscheider

Tagged as: security, storage, business intelligence. See more tags (10) at silicon.de page.

http://www.silicon.de/

Serverloft.de - serverloft Dedicated Server fr Profis

Dedizierte Server fr Profis mieten Stabile Marken-Hardware schnelle Anbindung 247-Support. Flexible Vertrge & Hosting in prmierten Rechenzentren in Europa & USA jetzt nutzen

Tagged as: internet, software, hosting. See more tags (23) at serverloft.de page.

http://www.serverloft.de/

What people search with server:

more...