MarkosWeb

covid-19 widget

Php Mysql websites probably the best selection from 3,730 total domains

Visitors who searched Php Mysql also search  php,  mysql,  web hosting

Masterhost.ru Favicon Masterhost.ru - 75

75 VPS colocation

Tagged as: tumaczenia pisemne. See more tags (2) at masterhost.ru page.

http://masterhost.ru/

Knowsky.com Favicon Knowsky.com - www.knowsky.com

jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop

Tagged as: mysql, linux, server. See more tags (10) at knowsky.com page.

http://knowsky.com/

Roseindia.net Favicon Roseindia.net - JSP TutorialsEJB TutorialJDBC TutorialsFree Java Servlets Tutorials WAP Tutorials Spring Framework Tutorials J2EE Tutorials BioInformatics Tutorials Java Server Faces Tutorials Jbo...

JSP TutorialEJB TutorialsOnline JDBC TutorialsFree Java Servlet TutorialsWAP TutorialsSpring Framework Tutorials BioInformatics Tutorials Java Server Faces Tutorials J2EE Tutorials Jboss Tutorials Hibernate Tutorials XML and MySQL Tutorials

Tagged as: e commerce, tell a friend, e commerce solutions. See more tags (11) at roseindia.net page.

http://roseindia.net/

Comze.com - Free Web Hosting with PHP MySQL and cPanel

Tagged as: web hosting, free web, free web hosting. See more tags (4) at comze.com page.

http://comze.com/

Php168.com Favicon Php168.com - b2bCMS

Tagged as: iletim. See more tags (2) at php168.com page.

http://www.qibosoft.com/

Webd.pl - Tani Profesjonalny Hosting WWW Serwery i Domeny od 399 PLN

Profesjonalne usugi hostingowe dla firm oraz uytkownikw indywidualnych. Serwery PHP MySQL. Rejestracja domen krajowych regionalnych oraz midzynarodowych

Tagged as: hosting, mysql, reseller. See more tags (16) at webd.pl page.

http://webd.pl/

Infomaniak.ch Favicon Infomaniak.ch - PHP & MySQL hosting - their top features 60 40 GB unlimited traffic PHP & MySQL Joomla Wordpress Prestashop Drupal spip typo3 phpbb vBulletin

Tagged as: iletim, bande passante. See more tags (3) at infomaniak.ch page.

http://www.infomaniak.com/

Comli.com - Free Web Hosting with PHP MySQL and cPanel

Tagged as: web hosting, free web, free web hosting. See more tags (5) at comli.com page.

http://comli.com/

Valuehost.ru Favicon Valuehost.ru - Professional Hosting Domains PHP Ruby on Rails Python Perl - ValueHost 2.0

is a leading provider of web hosting based in Silicon Valley California. Unlimited web space PHP Python RoR MySQL and PgSQL. Anytime money back hosting. Our web hosting network guaranteed 99.99% uptime

Tagged as: hosting, domain, webhosting. See more tags (7) at valuehost.ru page.

http://www.valuehost.ru/en/hosting/

Orgfree.com Favicon Orgfree.com - Free Web Hosting ftp php MySQL

Unmetered traffic 1500 MB Webspace PHP free MySQL database SSI Full Ftp and more

Tagged as: web hosting, free web, free web hosting. See more tags (10) at orgfree.com page.

http://orgfree.com/

6te.net Favicon 6te.net - Free Web Hosting ftp php MySQL

Unmetered traffic 1500 MB Webspace PHP free MySQL database SSI Full Ftp and more

Tagged as: web hosting, free web, free web hosting. See more tags (13) at 6te.net page.

http://6te.net/

Unas.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: hosting, mysql, iletim. See more tags (7) at unas.cz page.

http://www.webzdarma.cz/

Comuf.com - Free Web Hosting with PHP MySQL and cPanel

Tagged as: web hosting, free web, free web hosting. See more tags (5) at comuf.com page.

http://comuf.com/

Frihost.com Favicon Frihost.com - Frihost - Free php hosting and free domains

Tagged as: web hosting, internet, forum. See more tags (17) at frihost.com page.

http://www.frihost.com/

51js.com Favicon 51js.com - HTML

Tagged as: html, javascript, sql server. See more tags (7) at 51js.com page.

http://bbs.51js.com/

Comyr.com - Free Web Hosting with PHP MySQL and cPanel

Tagged as: web hosting, free web, free web hosting. See more tags (7) at comyr.com page.

http://comyr.com/

Scriptlance.com Favicon Scriptlance.com - Hire Freelancers & Find Freelance Jobs Online - Freelancer.com

Hire freelance programmers web developers designers writers data entry & more at a fraction of the cost on the World's Largest Outsourcing Marketplace

Tagged as: webdesign, search engine, search engine optimization. See more tags (23) at scriptlance.com page.

http://www.freelancer.com/?utm_expid=294858-54.y4dwHqwLR0uoKzhi2y8zCA.0

Phpmydirectory.com Favicon Phpmydirectory.com - phpMyDirectory - Web Portal Business Directory Classifieds Link Indexing

phpMyDirectory is the leading website portal solution. Build and manage a powerful website with ease. Built using PHP and MySQL phpMyDirectory can be used to create websites focused on a business directory classifieds link indexing and more...

Tagged as: mysql, business directory, e business. See more tags (24) at phpmydirectory.com page.

http://www.phpmydirectory.com/

Ueuo.com Favicon Ueuo.com - Free Web Hosting ftp php MySQL

Unmetered traffic 1500 MB Webspace PHP free MySQL database SSI Full Ftp and more

Tagged as: web hosting, free web, free web hosting. See more tags (11) at ueuo.com page.

http://ueuo.com/

Comoj.com - Hostinger Group - Web Hosting Domains VPS Billing Software

Tagged as: web hosting, free web, free web hosting. See more tags (5) at comoj.com page.

http://www.hostinger.com/?

Net23.net - Hostinger Group - Web Hosting Domains VPS Billing Software

Tagged as: web hosting, free web, free web hosting. See more tags (7) at net23.net page.

http://www.hostinger.com/?

Piranho.de Favicon Piranho.de - piranho

Soziales Netzwerk fr Webmaster

Tagged as: corporateevents, entertainmentportal, ingilizce szlk. See more tags (6) at piranho.de page.

http://piranho.de/home.php

Hosting24.com Favicon Hosting24.com - Hosting24.com - First Class Web Hosting

Providing reliable web hosting services with PHP MySQL cPanel Website Builder and 24x7 user support. Unbeatable price starting from $4.84mo

Tagged as: web hosting, hosting, website hosting. See more tags (13) at hosting24.com page.

http://hosting24.com/

Kvalitne.cz - webzdarma.cz - web e-mail a databze ... zdarma

Umstn va webov prezentace zdarma s podporou PHP MySQL

Tagged as: hosting, mysql, compaias de seguros. See more tags (9) at kvalitne.cz page.

http://www.webzdarma.cz/

Tufat.com Favicon Tufat.com - Darren's Script Archive - chatrooms image galleries applets advanced phpmysql systems website scripts flash xml ajax chat

Flash chat room online family tree builder Flash DataGrid phpMyAdmin Content Management Flash 2004 Image Gallery phpBB imagevuex html2ps html2pdf PDF generation Inspirational messages AMFPHP

Tagged as: content management system, flash, mysql. See more tags (28) at tufat.com page.

http://tufat.com/

Freehost10.com - Free Host with PHP and MySQL

We are a Web Hosting Portal that provides unlimited web space and unlimited bandwidth. PHP MySQL and PHPMyAdmin. Upload Blogs and forums too.Webmasters Host your site with us and save $$$!

Tagged as: web hosting, domain registration, free website. See more tags (18) at freehost10.com page.

http://freehost10.com/

Redaxo.de Favicon Redaxo.de - REDAXO - Content Management System CMS - Kostenlos - Frei - PHP - MySQL - Open-Source Simple To Use home - REDAXO

Einfach flexibel sinnvoll. REDAXO vereint hohe Flexibilität mit einfacher Handhabung für sinnvolle Nutzung. Es eignet sich sowohl für kleinere Auftritte als auch für große und komplexe Internetportale

Tagged as: management system, content management system, open source. See more tags (11) at redaxo.de page.

http://www.redaxo.org

Comuv.com - Hostinger Group - Web Hosting Domains VPS Billing Software

Tagged as: web hosting, free web, free web hosting. See more tags (4) at comuv.com page.

http://www.hostinger.com/?

Infobox.ru Favicon Infobox.ru - Infobox - Infobox.ru

InfoboxCloud - . ! VPS

Tagged as: fotografias areas. See more tags (2) at infobox.ru page.

http://infobox.ru

Dreamworker.de Favicon Dreamworker.de - dreamworker.de

dreamworker.de - Deine Community fr Fragen rund um Dreamweaver Photoshop Flash und allen Produkten der Adobe Creative Suite sowie Anlaufstelle fr Fragen zur Webentwicklung XHTML CSS JavaScript PHP Datenbanken SEO

Tagged as: xhtml css, creative suite. See more tags (3) at dreamworker.de page.

http://dreamworker.de

Dhost.info Favicon Dhost.info - DeluXe Host - 100MB Free Webspace - Home

dhost.info - Free Webhosting Provider - 100MB 300GB Traffic PHP MySQL FTP DeluXe Host offers 100MB Free Webspace with PHP5 and MySQL5

Tagged as: hosting, mysql, host. See more tags (12) at dhost.info page.

http://dhost.info

Mochahost.com Favicon Mochahost.com - MochaHost cPanel Hosting JSP Hosting PHP MySQL Hosting Frontpage Hosting

If you are looking for cpanel hosting as well as jsp hosting php mysql hosting and frontpage hosting please review our website. If you are also looking for perl hosting as well as drupal hosting ventrilo hosting and gallery hosting please v...

Tagged as: web hosting, hosting plans, asp net. See more tags (23) at mochahost.com page.

http://mochahost.com/

Agilityhoster.com - Free Web Hosting Service for Joomla and Wordpress

Free Web Hosting Service with PHP MySQL SMTP ON Joomla and Wordpress Installer

Tagged as: web hosting, hosting, mysql. See more tags (21) at agilityhoster.com page.

http://www.agilityhoster.com/

Dreamdu.com

Tagged as: xhtml css, geschenkbcher, hollywoodtours. See more tags (7) at dreamdu.com page.

http://www.dreamdu.com

Bookmark-manager.com Favicon Bookmark-manager.com - Blue Smiley Organizer - Open Source Online Organizer

Open Source Organizer for bookmarks calendar diary knowledge reminder notes and files. Download and install on your own server php mysql

Tagged as: open source, criao de logo, freetext. See more tags (6) at bookmark-manager.com page.

http://www.bookmark-manager.com/

M6.net Favicon M6.net - Windows Web Hosting ASP.Net Hosting & Reseller Hosting on Windows Servers from M6.net

Get a lot more Windows & ASP.Net hosting than any other provider with unlimited IIS web sites for a lot less. M6.Net is the original Windows hosting Provider with expertise in Windows Technology since 1997

Tagged as: web hosting, web designers, asp net. See more tags (20) at m6.net page.

http://www.m6.net/

W-shadow.com - W-Shadow.com Blog

A blog about web development software business and WordPress

Tagged as: blog, tips, programming. See more tags (12) at w-shadow.com page.

http://w-shadow.com/

Phpnuke.ir Favicon Phpnuke.ir - PHP-Nuke

PHPNuke.ir

Tagged as: multipleimages, php nuke. See more tags (3) at phpnuke.ir page.

http://www.phpnuke.ir/

Php-editors.com Favicon Php-editors.com - PHP Editor Review - PHP IDE

PHP Editor Review - PHP IDE PHP Developer PHP Editors and PHP IDE list biggest Php Editor and IDE list on the net. All Php Editors and IDEs are fully reviewed

Tagged as: calefaccin, php scripts, php programming. See more tags (24) at php-editors.com page.

http://php-editors.com/

Phpeasystep.com - PHPeasystep - Learn PHP and mySQL

PHP and MySQL tutorials News Downloads and Forums. Teach you step-by-step with easy simple php code

Tagged as: mysql, step by step, htmlcodes. See more tags (12) at phpeasystep.com page.

http://phpeasystep.com/

Ilmuwebsite.com - Cara Membuat Website Belajar PHP Belajar HTML Gratis

berisi cara membuat website free dan gratis di dalamnya Anda akan mempelajari html css php mysql adobe photoshop dan banyak lagi... Gratis!

Tagged as: webdesign, news, html. See more tags (20) at ilmuwebsite.com page.

http://www.ilmuwebsite.com/

Iguso.com

400-6015-035

Tagged as: sql server, dsl vertrge, hndverker. See more tags (9) at iguso.com page.

http://iguso.com

Html.de Favicon Html.de - html.de - HTML fr Anfnger und Fortgeschrittene

Tagged as: mysql, linux, html. See more tags (12) at html.de page.

http://www.html.de/

Phpdig.net Favicon Phpdig.net - PhpDig.net - Web Spider and Search Engine

Web Spider and Search Engine

Tagged as: search engine, hndverker, raisemoney. See more tags (4) at phpdig.net page.

http://phpdig.net/

Mchost.ru Favicon Mchost.ru - c php mysql

2004

Tagged as: web hosting, calefaccin. See more tags (3) at mchost.ru page.

http://mchost.ru

Scratch99.com Favicon Scratch99.com - WordPress Website Management and Web Development

Stephen Cronin writes about web development using PHP MySQL CSS Javascript Ajax and about blogging via WordPress

Tagged as: webdesign, blog, web development. See more tags (13) at scratch99.com page.

http://scratch99.com

Oxyhost.com Favicon Oxyhost.com - What is your age and gender

Tagged as: web hosting, mysql, email. See more tags (20) at oxyhost.com page.

http://us2.hsicell.com/router.php

Contrexx.com Favicon Contrexx.com - Contrexx - Das prmierte Open Source Website Management System CMS

Contrexx ist eine branchenunabhngige Website Management CMS und E-Commerce Lsung fr Unternehmen. Als Open-Source-Software wie auch in kommerziellen Editionen zur Verfgung

Tagged as: management system, content management system, open source. See more tags (16) at contrexx.com page.

http://www.contrexx.com/de/

Searches related to: php mysql

What people search with php mysql:

more...