xdot GmbH Services

159.255.168.2 Germany

OK

Joerg Fester (x-dot GmbH)
Address: Feldstiege 78, 48161, Muenster, DE
Phone: +492533281180
Mail: [email protected]
Joerg Fester affiliated with 62 domains.

ns1.x-dot.de (IP 159.255.168.253)
Other domains using this NS: 56
ns2.x-dot.de (IP 159.255.169.253)
Other domains using this NS: 56

Whois lookup

$13,249

3.73%

all domain wigdets

all worth widgets

Not certified

Post a review

druck, belichtung, hannover, lippe, publishing, offset, film, visitenkarten, prospekte, druckmaschinen, scan, scanner, layout, postscript, bellyfat, flightsonly

sigert.de, lookpic.at, atelier-erdmann.de, druckerei-sander.de, crevo.net, mohrdruck.de, eicheldruck.de, rotabene.de, garrido-druck.de, hokamp-druck.de.

druck (17%, $2.02), belichtung (11%, $1.28), lippe (8%, $0.56), hannover (8%, $1.01), offset (6%, $2.09)

This domain is found only in Denmark local organic SERPs.

internal 2, external 0

OK

Strangfeld Druck - Satz Druck und Veredelung

drucksatzveredelungoffsetdtplithoeuroskalakalletalhannoverlippeowllemgopublishingbroschrenprospektevisitenkartenkaschierenmacfilmbelichtunglayoutscanscanservicescannerbelichtungbelichterpostscriptdpiplattenkopiedruckmaschinenfalzenprgenlithographiestanzenlackierenbroschrenfalz

Offsetdruck und mehr - eigene Druckvorstufe mit Belichter macht uns unabhngig und flexibel. Satz Veredelung Prgen - umfangreicher Service von Lippe bis Hannover

Get the latest updates on strangfeld.de via RSS

Domain name is seen on 2 search engine queries. Average position in SERP is 32. Best position in SERP for this domain is #32 (it's found 2 times). Statistical information was collected from April 22, 2012 to April 22, 2012

Visualizes organic positions distribution for domain pages that were found in top 40 results.