Rackspace Hosting

office +1-210-312-4000

98.129.229.145 United States (1 changes since April 12, 2012)

April 12, 2012 68.178.232.99 (GoDaddy.com) → 98.129.229.145(Rackspace Hosting)

OK

dns1.stabletransit.com (IP 69.20.95.4)
Other domains using this NS: 26,458
dns2.stabletransit.com (IP 65.61.188.4)
Other domains using this NS: 26,451

Whois lookup

11 years and 4 months

$31,896

1.55%

all domain wigdets

all worth widgets

Not certified

Post a review

service, design, support, computer repair, tech support, webdesign, service web, repair service, computer repair service, web design hosting, fort walton beach, walton, websites, marketing, itil, comptia, computer tech support, computer problems, problems, help desk, windows 95, seaside, destin, microsoft windows 2000, customer support, computer technical support, windows nt, technical support, helpdesk, windows 98, d politika, sinhalabreakingnews

pacepcsolutions.com, centumq.com, computer-support.com, boisecomputerservice.com, computerz101.com, info-techs.com, ithelpcrew.com, techmanrog.com, techguy.org.

support (7%, $2.49), service (7%, $2.85), design (7%, $2.21), computer repair (7%, $6.69), tech support (5%, $4.05)

internal 13, external 8

2 changes recorded

Error

Logic Unlimited Homepage

computer repairservicemarketingdesignwebsitesweb siteITILhelp deskhelpdeskon-site servicecomputer technical supportcomptiaDestin servicepc tech supportcomputer tech supportpc supportcomputer helpmicrosoft windowswindows 95problemscomputer problemswindows 98win98windows ntmicrosoft windows 2000assisted supportcustomer supportreduce support costsservice managersupportsupport alliancesupport solutions technical supporttechnical support solutionsweb-based supportDestinFort Wa

1 links (from 1 unique hosts)
Examples: einfodes.net

Get the latest updates on logicul.com via RSS

This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)