Hetzner Online AG (Hetzner Online AG Datacenter 12)

+49 9831 61 00 61

176.9.46.84 Germany (3 changes since October 26, 2009)

August 6, 2011 178.63.52.195 → 176.9.46.84
July 15, 2011 88.198.215.180 → 178.63.52.195
October 26, 2009 88.198.215.179 → 88.198.215.180

OK

NIC-AT domain profile
Domains using same registrar:31,960

Andreas Dolleschal (Developer AT GmbH)
Address: Posthorngasse 5/1, A-1030, Wien, Austria
Phone: +4312740077
Mail: [email protected]

Whois lookup

2,798 (▲ 2,434)
diff as of January 1, 2010

$44,826

22.46%

all domain wigdets

all worth widgets

Not certified

Post a review

Facebook

typo3, internet, austria, delphi, grafik, technologie, campaign, consulting, asterisk, grafics, kontrolle, stylesheet, coldfusion, sipps, apache, flash, solutions, html, voip, business, agentur, puzzle, email, webserver, wien, design, newsletter, indianidol

foerderkompass.at, mmc.at, netnnet.de, latimera.net, kaliber5.de, dumont-neue-medien.de, champsolutions.net, net-n-net.de, latimera.de, web-tech.at.

typo3 (7%, $2.71), internet (4%, $3.45), austria (4%, $1.86), campaign (4%, $3.42), delphi (4%, $0.93)

This domain is found only in Denmark local organic SERPs.

351 (▲26)

3,145 (▼600)

internal 67, external 4

1 changes recorded

Error

Developer AT GmbH TYPO3 Entwicklung und TYPO3 Schulungen fr Unternehmen und Agenturen

typo3sterreichzertifiziertagenturextensiontemplatepluginerweiterunghilfeschulungentwicklungprofireferenzcontent managementwienaustriawaibarrierefreihostinginternetsecurityfirewallphpmysqldevelopmentportalusergroupwebdesignwebhostingwaphtmlwmlcssstylesheetflashgrafikdesigndelphikontrollewebserverapachenewslettercampaignemailconsultingbusinesstechnologiesolutionsvoipip-telefonasteriskjquerytypo3 agentur sterreichsoftwarelsung

Wir schaffen effiziente IT-Lsungen fr Ihre Betriebsprozesse. Egal ob im Web auf mobilen Endgerten oder im Backoffice hilft Ihnen unsere Erfahrung Zeit und Geld zu sparen. Seit vielen Jahren sind wir TYPO3 Experte und zertifizierter TYPO3 Integrator

2 links (from 2 unique hosts)
Examples: notizblog.de, novahidayana.blogspot.com

Get the latest updates on developer.at via RSS

Domain name is seen on 3 search engine queries. Average position in SERP is 26. Best position in SERP for this domain is #18 (it's found 1 times). Statistical information was collected from April 22, 2012 to April 22, 2012

Visualizes organic positions distribution for domain pages that were found in top 40 results.