(GoDaddy.com, LLC)

office +1-480-624-2505

23.229.175.72

False explanation

Whois lookup

6 years and 4 months

$18,714

3.74%

all domain wigdets

all worth widgets

Not certified

Post a review

Twitter

e business, business to business, scanner, office 2007, autocad, modem, monitor, ipaq, switch, print server, lacie, cisco, tastiera, blackberry, batterie, vmware, batteria, point, lenovo, plantronics, access, usb hub, phone, michiganbankruptcy

bechtle.be, bechtle.co.uk, gadget.md, netstoredirect.com, eu-energystar.org, comfort.hu, wlan-shop.nl, adsi.nl, linksys-shop.ch.

e business (19%, $3.59), scanner (6%, $2.65), office 2007 (6%, $1.63), business to business (6%, $4.30), usb hub (3%, $1.25)

internal 295, external 8

OK

Bechtle direct Italia - Prodotti IT e software - Business to Business e Business to Government

mouseapcupsscannerlacieswitchtastierakvmnotebook alimentatoreq2612afaxnas monitorpatchpanel usbprint serverhard disknokiaheadset monitorbelkiniomegadymo webcamdvdautocadasus accesspointlenovooffice 2007dc7800hpbatterie batteriavmwarehtcmodem kvmups ciscop2015ipaqphoneplantronicsscannerprintserver lenovooffice 2007usb hubusb kabelnetzteiltomtom digitalkamerablackberry

Ordinare da www.bechtle.it hardware software e altro ancora del mondo IT e della telecomunicazione

Get the latest updates on becissp.com via RSS

This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)