MarkosWeb

covid-19 widget

zonecss.fr

Bienvenue sur la ZONE CSS ZONE CSS - Les css et leurs relations avec le...

edit
Glossaire sur les Cascading Style Sheets css css1 css2 css3 ou feuilles de style en cascade.Vous trouverez des cours pour intégrer les feuilles de style formater votre document HTML XHTML des astuces pour les feuilles de style css ou le html xhtml dhtml et javascript concutpar DMC... read more



Rating:
4.3 of 5 (4 votes)
Indexed pages:
1,220 (101)
Backwards:
2,493 (5)
Links from homepages:
15 links (from 4 hosts)
updated November 6, 2013
Homepage links:
internal 35, external 19
Unique visitors:
13,428 ( 8,895)
diff as of July 1, 2013
Snapshot history:
25 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
OK
DNS resolve:
OK
Domain worth:
$138,540
Health score:
48.91%

Technical

Website availability: (is site down?)

Latest result: Website is UP

Latest test time and date: 6:33:47 AM November 1, 2013

Latest test duration: 0.808 seconds


Test results (detailed CURL answer)
HTML size: 18700 bytes
Url: http://www.zonecss.fr/index.php
Content_type: text/html; charset=ISO-8859-1
Http_code: 200
Header_size: 1076
Request_size: 577
Filetime: -1
Redirect_count: 2
Total_time: 0.805906
Namelookup_time: 1.1E-5
Connect_time: 1.4E-5
Pretransfer_time: 3.1E-5
Size_download: 18700
Speed_download: 23203
Download_content_length: 18700
Starttransfer_time: 0.123556
Redirect_time: 0.516475
Used technologies:
Analytics
Google Analytics
Javascript frameworks
jQuery
Miscellaneous
SWFObject
Programming languages
PHP (version 5.3.16)
Web servers
Apache
Widgets
AddThis (version 250)
Hosting:
OVH SAS (OVH SAS Shared Hosting Servers http://www.ovh.com)
Hosting admin phone:
+33 9 74 53 13 23
Hosting admin mail:
Domain IP:
213.186.33.4 France
DNS Resolve:
OK
Domain registrar:
AFNIC domain profile
Domains using same registrar:82,955
Domain technical support:

Address: OVH, 140, quai du Sartel, 59100 Roubaix, FR
Phone: +33899701761
Mail: [email protected]
affiliated with 25,150 domains.
Public registrar record:

Profile

Unique visitors:
13,428 ( 8,895)
diff as of July 1, 2013
Domain age:
12 years and 3 months
Domain worth:
$138,540
Health score:
48.91%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #zonecss.fr

Social activity: updated 13 May 2014
MarkosWeb reviews:
Social Contacts:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
style (10%, $1.14), css html (9%, $1.13), html (8%, $1.36), feuille (7%, $0.48), xhtml (6%, $0.95)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    1,220 (101)
    Backwards:
    2,493 (5)
    Homepage links:
    internal 35, external 19
    Title history:
    1 changes recorded
    HTML validation:
    OK
    Title:
    Bienvenue sur la ZONE CSS ZONE CSS - Les css et leurs relations avec les balises HTML et XHTML dfinitions css V4.0
    Meta-keywords:
    Zone csscssstylefeuillefeuilles de stylecss htmlhtml cssxhtmlhtmlcascadingstylesheetscss2css1css3css levelstylestylesfeuillefeuilles de stylescascadecascading style sheetsdocument object modeljavascriptpositionnementrelatifabsolucouleursfontdynamic htmldébutantscripttutorialdébutercoursscriptslinkdivspanlayerscalquescouchespositionabsoluterelativeDHTMLhtmldynamiquelangageslanguagesbalisesbalisescriptcréation de sitescreation de sites
    Meta-description:
    Glossaire sur les Cascading Style Sheets css css1 css2 css3 ou feuilles de style en cascade.Vous trouverez des cours pour intégrer les feuilles de style formater votre document HTML XHTML des astuces pour les feuilles de style css ou le html xhtml dhtml et javascript concut par DMC
    Links from homepages:(detailed)
    15 links (from 4 unique hosts)
    Examples: aliasdmc.fr, aliasdmc.free.fr, aliasdmc.com, zonecss.free.fr
    MarkosWeb Domain RSS:
    Get the latest updates on zonecss.fr via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 722 search engine queries. Average position in SERP is 12. Best position in SERP for this domain is #1 (it's found 51 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.