MarkosWeb

covid-19 widget

stayfriends.se

StayFriends Skmotorn fr vnner och klasskamrater i Sverige

edit
Finn med StayFriends - skmotorn fr vnner - gamla klasskamrater kolleger skolkamrater krlekar och frsvunna vnner!



Rating:
5 of 5 (2 votes)
Indexed pages:
88,229 (740)
Backwards:
5,857,246 (48,418)
Links from homepages:
8 links (from 8 hosts)
updated November 6, 2013
Homepage links:
internal 59, external 6
Unique visitors:
5,812 ( 3,609)
diff as of July 1, 2013
Snapshot history:
38 available via snapshot tool
HTML validation:
Error
DNS resolve:
OK
Domain worth:
$647,351
Health score:
67.59%
Google updates:

Technical

Website availability: (is site down?)

Latest result: Website is DOWN

Latest test time and date: 7:00:00 PM December 31, 1969

Latest test duration: seconds


Error details: %1$sDNS not resolved.

Operation does not return any results

Used technologies:
Analytics
Google Analytics
Javascript frameworks
jQuery
ExtJS
Web servers
Apache Tomcat (version 1.1)
Hosting:
Stayfriends GmbH (StayFriends GmbH)
Hosting admin phone:
+499131940230
Hosting admin mail:
Domain IP:
91.236.107.21 Germany (multiple IPs)
DNS Resolve:
OK
Domain registrar:
NIC-SE domain profile
Domains using same registrar:36,287
Name server (NS) records:
b.stayfriends.com (IP 217.160.113.130)
Other domains using this NS: (7): stayfriends.de, trombi.com, stayfriends.at, klassenfreunde.ch, stayfriends.ch, stayfriends.com, abschlusszeit.de
c.stayfriends.com (IP 89.146.248.95)
Other domains using this NS: (9): stayfriends.de, trombi.com, stayfriends.at, klassenfreunde.ch, stayfriends.ch, stayfriendsforever.com, stayfriends.com, abschlusszeit.de, stayfriends-bayern.de
d.stayfriends.com (IP 74.208.254.94)
Other domains using this NS: (9): stayfriends.de, trombi.com, stayfriends.at, klassenfreunde.ch, stayfriends.ch, stayfriendsforever.com, stayfriends.com, abschlusszeit.de, stayfriends-bayern.de
Public registrar record:

Profile

Unique visitors:
5,812 ( 3,609)
diff as of July 1, 2013
Domain age:
16 years and 8 months
Domain worth:
$647,351
Health score:
67.59%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #stayfriends.se

Social activity: updated 5 Aug 2014
Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
universitet (10%, $0.81), skola (10%, $0.74), grundskola (10%, $0.67), personer (10%, $0.70), gymnasieskola (10%)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    88,229 (740)
    Backwards:
    5,857,246 (48,418)
    Homepage links:
    internal 59, external 6
    HTML validation:
    Error
    Google updates:
    Title:
    StayFriends Skmotorn fr vnner och klasskamrater i Sverige
    Meta-keywords:
    StayFriendsskmotorn fr vnnerskklasstrffenklasstrffvnnerklasskamraterskolkamraterfinnafrsvunnenpersonskningpersonerkollegervnvnninaskoltidalumnistudentkamratersvensk skolarealskolayrkesskolafolkskolagrundskolagymnasieskolahgskolauniversitetflickskolafolkskolaskolagymnasiumavgngsklassklasssaknadeftersktskapersonterfinnaterfreningsktmnniskormnniskapartneranhrigamaildtidrgngtrfflrare
    Meta-description:
    Finn med StayFriends - skmotorn fr vnner - gamla klasskamrater kolleger skolkamrater krlekar och frsvunna vnner!
    Links from homepages:(detailed)
    Smartviper Domain RSS:
    Get the latest updates on stayfriends.se via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 6 search engine queries. Average position in SERP is 19. Best position in SERP for this domain is #1 (it's found 1 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.