MarkosWeb

covid-19 widget

softcam.tv

Softcam.Tv Team All Times Updated SoftCam Key Other Daily Key Files

edit
softcam key satellite sat cardsharing software skyview file software yankse dvb mytheatre progdvb cwcamemu plugin inca aver skystar download wincsc hadu flycccam newcamd gbox satbazaar s2emu vplug biss polsat dreambox



Rating:
4.3 of 5 (3 votes)
Indexed pages:
45 (2)
Backwards:
2,257 (113)
Links from homepages:
2 links (from 2 hosts)
updated November 6, 2013
Homepage links:
internal 3, external 4
Unique visitors:
2,521 ( 1,759)
diff as of July 1, 2013
Snapshot history:
38 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
Error
DNS resolve:
OK
Domain worth:
$55,134
Health score:
13.53%

Technical

Website availability: (is site down?)
Used technologies:
Analytics
Google Analytics
Operating systems
UNIX
Programming languages
PHP (version 5.2.10)
Web servers
Apache (version 2.2.24)
Hosting abuse phone:
office +1-480-212-1710
Hosting abuse mail:
Domain IP:
64.120.55.243 United States (3 changes since July 5, 2009)
IP history:
March 19, 2010 69.163.47.33 (DirectSpace Networks, LLC.) → 64.120.55.243(Nobis Technology Group, LLC)
January 14, 2010 91.205.174.53 (Michael Boelke und Michael Herpich GbR) → 69.163.47.33(DirectSpace Networks, LLC.)
July 5, 2009 193.164.133.35 (Michael Boelke und Michael Herpich GbR) → 91.205.174.53(Michael Boelke und Michael Herpich GbR)
DNS Resolve:
OK
Domain registrar:
GODADDY.COM, LLC domain profile
Domains using same registrar:1,364,460
Name server (NS) records:
ns1.worldsat.org (IP 64.120.55.242)
Other domains using this NS: (2): cardserver.org, freecardsharing.org
ns2.worldsat.org (IP 64.120.55.243)
Other domains using this NS: (2): cardserver.org, freecardsharing.org
NS history:
6 changes since July 5, 2009
June 10, 2011 ns1.worldsat.org
ns2.worldsat.org
ns1.worldsat.org
ns2.worldsat.org
ns3.worldsat.org
June 3, 2011 ns1.worldsat.org
ns2.worldsat.org
ns3.worldsat.org
ns1.worldsat.org
ns2.worldsat.org
April 3, 2010 ns1.worldsat.org
ns2.worldsat.org
ns1.worldsat.org
ns2.worldsat.org
ns3.worldsat.org
March 19, 2010 ns1.cardserver.org
ns2.cardserver.org
ns1.worldsat.org
ns2.worldsat.org
View all history of variations.
Public registrar record:

Profile

Unique visitors:
2,521 ( 1,759)
diff as of July 1, 2013
Domain age:
12 years and 2 months
Domain worth:
$55,134
Health score:
13.53%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #softcam.tv

Social activity: updated 25 Mar 2014
MarkosWeb reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
softcam (33%, $0.87), softcam key (28%), cardsharing (7%, $0.44), skystar (7%, $0.59), dreambox (7%, $0.50)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    45 (2)
    Backwards:
    2,257 (113)
    Homepage links:
    internal 3, external 4
    Title history:
    1 changes recorded
    HTML validation:
    Error
    Title:
    Softcam.Tv Team All Times Updated SoftCam Key Other Daily Key Files
    Meta-keywords:
    softcamkeysatellitecardsharingfilepluginskystardreambox
    Meta-description:
    softcam key satellite sat cardsharing software skyview file software yankse dvb mytheatre progdvb cwcamemu plugin inca aver skystar download wincsc hadu flycccam newcamd gbox satbazaar s2emu vplug biss polsat dreambox
    Links from homepages:(detailed)
    2 links (from 2 unique hosts)
    Examples: minotavrs.blogspot.com, freecardsharing.org
    MarkosWeb Domain RSS:
    Get the latest updates on softcam.tv via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 33 search engine queries. Average position in SERP is 17. Best position in SERP for this domain is #1 (it's found 3 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.