MarkosWeb

covid-19 widget

robrohan.com

Times New Rohan

edit
Technology tips tricks rants howtos reviews - just plain random technology from the mind of Rob Rohan with a bit of Chinese in for fun



Rating:
4 of 5 (5 votes)
Indexed pages:
1,178 (134)
Backwards:
1,958 (68)
Links from homepages:
6 links (from 4 hosts)
updated November 6, 2013
Homepage links:
internal 21, external 5
Unique visitors:
668 ( 457)
diff as of April 1, 2012
Snapshot history:
23 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
OK
DNS resolve:
OK
Domain worth:
$131,681
Health score:
44.87%

Technical

Website availability: (is site down?)

Latest result: Website is DOWN

Latest test time and date: 7:00:00 PM December 31, 1969

Latest test duration: seconds


Error details: %1$sDNS not resolved.

Operation does not return any results

Used technologies:
Analytics
Google Analytics
Operating systems
Ubuntu
Web servers
Apache (version 2.2.14)
Hosting:
Amazon.com (Amazon.com, Inc.)
Hosting abuse phone:
office +1-206-266-4064
Hosting abuse mail:
Domain IP:
174.129.5.127 United States
DNS Resolve:
OK
Domain registrar:
GODADDY.COM, LLC domain profile
Domains using same registrar:1,364,460
Name server (NS) records:
ns27.domaincontrol.com (IP 216.69.185.14)
Other domains using this NS: 10,803
ns28.domaincontrol.com (IP 208.109.255.14)
Other domains using this NS: 10,842
Public registrar record:

Profile

Unique visitors:
668 ( 457)
diff as of April 1, 2012
Domain age:
19 years and 5 months
Domain worth:
$131,681
Health score:
44.87%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #robrohan.com

Social activity: updated 15 Jul 2014
Smartviper reviews:
Social Contacts:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
chinese (12%, $0.89), eclipse (7%, $2.12), linux (7%, $2.46), widget (7%, $1.34), windows (7%, $2.22)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    1,178 (134)
    Backwards:
    1,958 (68)
    Homepage links:
    internal 21, external 5
    Title history:
    1 changes recorded
    HTML validation:
    OK
    Title:
    Times New Rohan
    Meta-keywords:
    robrob rohanmacosxlinuxmusicguitarphpgroovyjavaaspchinesesafariwidgetframeworkpinyinmvcafaeeclipsewindowsweb design
    Meta-description:
    Technology tips tricks rants howtos reviews - just plain random technology from the mind of Rob Rohan with a bit of Chinese in for fun
    Links from homepages:(detailed)
    6 links (from 4 unique hosts)
    Examples: abdulqabiz.com, ymacs.org, xiaocidian.com, michael-mccracken.net
    Smartviper Domain RSS:
    Get the latest updates on robrohan.com via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 89 search engine queries. Average position in SERP is 24. Best position in SERP for this domain is #5 (it's found 2 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.