
covid-19 widget - finn aviser tidsskrifter magasiner nyheter m.m

Finn aviser tidsskrifter magasiner nyheter online - norske nordiske europeiske og fra andre deler av verden

4.7 of 5 (3 votes)
Indexed pages:
26,349 (2,498)
Links from homepages:
20 links (from 11 hosts)
updated November 6, 2013
Homepage links:
internal 43, external 928
Unique visitors:
3,097 ( 1,425)
diff as of July 1, 2013
Snapshot history:
38 available via snapshot tool
HTML validation:
DNS resolve:
Domain worth:
Health score:


Website availability: (is site down?)
Used technologies:
Web servers
Apache (version 2.2.16)
Domeneshop (Domeneshop AS)
Hosting admin phone:
+47 22 94 33 33
Hosting admin mail:
Domain IP: Norway
DNS Resolve:


Unique visitors:
3,097 ( 1,425)
diff as of July 1, 2013
Domain worth:
Health score:
Domain score widget:
Domain worth widget:
MarkosWeb certification:


Social activity: updated 24 Jun 2014
MarkosWeb reviews:


AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
aviser (20%, $0.64), online (15%, $3.19), avis (13%, $5.87), stena line (11%, $1.00), magasiner (9%, $1.00)
Ads SERP visibility: based on research of 16,000,000 keywords


Audience location:
Minimum required screen width is 768 - Please use other device to view


Indexed pages:
26,349 (2,498)
Homepage links:
internal 43, external 928
HTML validation:
Title: - finn aviser tidsskrifter magasiner nyheter m.m
avisaviserlokalaviserriksavisertidsskrifttidsskriftermagasinernyhetnyheteronlinenettavisnettavisernewsnewspapersnorske avisersvenske aviserdanske aviserfagtidsskrifternorskefagtidsskriftklikkher
Finn aviser tidsskrifter magasiner nyheter online - norske nordiske europeiske og fra andre deler av verden
MarkosWeb Domain RSS:
Get the latest updates on via RSS
SERP organic visibility: based on research of 16,000,000 keywords
This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)