MarkosWeb

covid-19 widget

knowsky.com

Www.knowsky.com

edit
jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop



Rating:
5 of 5 (2 votes)
Indexed pages:
364,234 (6,095)
Backwards:
341,700 (510)
Links from homepages:
65 links (from 55 hosts)
updated November 6, 2013
Homepage links:
internal 120, external 243
Unique visitors:
94,068 ( 44,061)
diff as of July 1, 2013
Snapshot history:
32 available via snapshot tool
HTML validation:
OK
DNS resolve:
False explanation
Domain worth:
$2,741,177
Health score:
46.07%
Google updates:

Technical

Website availability: (is site down?)
Used technologies:
Operating systems
Windows Server
Web servers
IIS (version 6.0)
Hosting:
Hosting admin phone:
+86-10-58501724
Hosting admin mail:
Domain IP:
112.124.65.211 China (2 changes since July 3, 2009)
IP history:
June 18, 2010 222.73.254.85 (ChinaNet Shanghai Province Network) → 112.124.65.211(Hangzhou Alibaba Advertising Co.,Ltd.)
July 3, 2009 210.51.25.216 (CNCGROUP IP network) → 222.73.254.85(ChinaNet Shanghai Province Network)
DNS Resolve:
False explanation
Domain registrar:
BEIJING INNOVATIVE LINKAGE TECHNOLOGY LTD. DBA DNS.COM.CN domain profile
Domains using same registrar:21,976
Name server (NS) records:
ns2.dns.com.cn (IP 183.60.228.253)
Other domains using this NS: 2,900
ns1.dns.com.cn (IP 183.60.228.253)
Other domains using this NS: 2,416
Public registrar record:

Profile

Unique visitors:
94,068 ( 44,061)
diff as of July 1, 2013
Domain age:
20 years and 2 days
Domain worth:
$2,741,177
Health score:
46.07%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #knowsky.com

Social activity: updated 19 Oct 2013
MarkosWeb reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
server (11%, $4.15), apache (11%, $1.44), develop (11%, $1.84), oracle (11%, $2.54), guestbook (11%, $0.72)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view

SEO

Indexed pages:
364,234 (6,095)
Backwards:
341,700 (510)
Homepage links:
internal 120, external 243
HTML validation:
OK
Google updates:
Title:
www.knowsky.com
Meta-keywords:
jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop
Meta-description:
jspaspsqlphpmysqlserverapacheiistomcatoraclejavaLINUXNTguestbookdevelop
MarkosWeb Domain RSS:
Get the latest updates on knowsky.com via RSS
SERP organic visibility: based on research of 16,000,000 keywords
This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)