MarkosWeb

covid-19 widget

kiralikseyler.com

Kiralk yazlk araba ev makina kamyonet kamyon jeneratr tekne ve dier kira...

edit
Kiralk araba ev yazlk tekne makinakamyonet kamyontransmikser ve daha birok ihtiyacnz kolaca kiralkseyler.com'da bulabilirsiniz



Rating:
5 of 5 (1 votes)
Indexed pages:
504 (8)
Backwards:
127 (15)
Homepage links:
internal 201, external 1
Unique visitors:
605 ( 1,629)
diff as of January 1, 2010
Snapshot history:
26 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
Error
DNS resolve:
OK
Domain worth:
$1,166
Health score:
19.85%

Technical

Website availability: (is site down?)

Latest result: Website is DOWN

Latest test time and date: 7:00:00 PM December 31, 1969

Latest test duration: seconds


Error details: %1$sDNS not resolved.

Operation does not return any results

Used technologies:
Analytics
Google Analytics
Hosting panels
Plesk
Operating systems
CentOS
Programming languages
PHP (version 4.3.9)
Web servers
Apache (version 2.0.52)
Hosting:
Hosting admin phone:
+90 212 3269200
Hosting admin mail:
Domain IP:
212.58.2.22 Turkey
DNS Resolve:
OK
Domain registrar:
REGISTER.COM, INC. domain profile
Domains using same registrar:90,485
Name server (NS) records:
dns1.doruk.net.tr (IP 212.58.4.2)
Other domains using this NS: 80
dns2.doruk.net.tr (IP 212.58.3.2)
Other domains using this NS: 73
dns3.doruk.net.tr (IP 212.58.5.22)
Other domains using this NS: 29
NS history:
9 changes since October 27, 2009
February 26, 2012 dns1.doruk.net.tr
dns2.doruk.net.tr
dns3.doruk.net.tr
dns1.doruk.net.tr
dns2.doruk.net.tr
December 2, 2011 dns1.doruk.net.tr
dns2.doruk.net.tr
dns1.doruk.net.tr
dns2.doruk.net.tr
dns3.doruk.net.tr
November 30, 2011 dns1.doruk.net.tr
dns2.doruk.net.tr
dns3.doruk.net.tr
dns1.doruk.net.tr
dns2.doruk.net.tr
April 8, 2011 dns1.doruk.net.tr
dns2.doruk.net.tr
dns1.doruk.net.tr
dns2.doruk.net.tr
dns3.doruk.net.tr
View all history of variations.
Public registrar record:

Profile

Unique visitors:
605 ( 1,629)
diff as of January 1, 2010
Domain age:
12 years and 7 months
Domain worth:
$1,166
Health score:
19.85%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #kiralikseyler.com

Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
makina (20%, $0.49), araba (20%, $0.99), aksesuar (7%, $0.49), kamera (7%, $0.83), medikal (7%, $0.36)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view

SEO

Indexed pages:
504 (8)
Backwards:
127 (15)
Homepage links:
internal 201, external 1
Title history:
1 changes recorded
HTML validation:
Error
Title:
Kiralk yazlk araba ev makina kamyonet kamyon jeneratr tekne ve dier kiralama ihtiyalar iin tklayn
Meta-keywords:
kiralkarabaevyazlkteknemakina sahibinden kiralk araba sahibinden kiralk otokamyonet kamyonekskavatrsilindirgreyderkamyonatvminibshiltitransmikserpanelvantrkamyon kiralamakamyonet kiralamadozer
Meta-description:
Kiralk araba ev yazlk tekne makinakamyonet kamyontransmikser ve daha birok ihtiyacnz kolaca kiralkseyler.com'da bulabilirsiniz
Smartviper Domain RSS:
Get the latest updates on kiralikseyler.com via RSS
SERP organic visibility: based on research of 16,000,000 keywords
This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)