MarkosWeb

covid-19 widget

gemal.dk

Gemal.dk - Gemal's Psyched Blog

edit
A blog about Mozilla development and other open source development



Rating:
4 of 5 (1 votes)
Indexed pages:
3,058 (170)
Backwards:
15,319 (160)
Links from homepages:
5 links (from 5 hosts)
updated November 6, 2013
Homepage links:
internal 72, external 20
Unique visitors:
10,170 ( 7,471)
diff as of November 1, 2012
Snapshot history:
15 available via snapshot tool
HTML validation:
OK
DNS resolve:
OK
Domain worth:
$72,748
Health score:
49.71%

Technical

Website availability: (is site down?)
Used technologies:
Analytics
Google Analytics
Web servers
Apache
Hosting:
Unified Layer (WEBSITEWELCOME.COM)
Hosting abuse phone:
office +1-866-964-2867
Hosting abuse mail:
Domain IP:
192.254.189.169 United States (1 changes since July 21, 2009)
IP history:
July 21, 2009 74.54.97.210 (THEPLANET.COM INTERNET SERVICES) → 192.254.189.169(Unified Layer)
DNS Resolve:
OK

Profile

Unique visitors:
10,170 ( 7,471)
diff as of November 1, 2012
Domain worth:
$72,748
Health score:
49.71%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #gemal.dk

Social activity: updated 19 Oct 2013
MarkosWeb reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
mozilla (15%), india (10%, $0.97), denmark (10%, $2.42), version (10%, $1.80), javascript (10%, $0.99)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    3,058 (170)
    Backwards:
    15,319 (160)
    Homepage links:
    internal 72, external 20
    HTML validation:
    OK
    Title:
    gemal.dk - Gemal's Psyched Blog
    Meta-keywords:
    gemalbrowserspyindiatripversionbrowserspymozillaprivacyjavascriptipindiatraveldenmarklinky
    Meta-description:
    A blog about Mozilla development and other open source development
    Links from homepages:(detailed)
    MarkosWeb Domain RSS:
    Get the latest updates on gemal.dk via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 98 search engine queries. Average position in SERP is 21. Best position in SERP for this domain is #4 (it's found 2 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.