MarkosWeb

covid-19 widget

enameco.com

ENameCo Domain Name Registration - Register Your Domain Today!

edit
Domain registration and enterprise class domain management



Rating:
4 of 5 (1 votes)
Indexed pages:
3 (8)
Backwards:
350 (39)
Links from homepages:
2 links (from 1 hosts)
updated November 6, 2013
Homepage links:
internal 0, external 11
Snapshot history:
24 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
Error
Duplicates:
Duplicates: with similar meta description: 11, with similar title: 11. Details
DNS resolve:
OK
Domain worth:
$39,692
Health score:
25.38%

Technical

Website availability: (is site down?)
Used technologies:
Programming languages
PHP (version 5.2.17)
Web servers
Apache (version 2)
Hosting:
Hosting abuse phone:
office +1-877-875-4311
Hosting abuse mail:
Domain IP:
38.113.1.225 United States (1 changes since February 24, 2010)
IP history:
February 24, 2010 216.34.94.184 (SAVVIS Communications Corporation) → 38.113.1.225(Endurance International Group)
DNS Resolve:
OK
Domain registrar:
ENAMECO LLC domain profile
Domains using same registrar:271
Name server (NS) records:
ns10.enameco.com (IP 63.251.83.73)
ns9.enameco.com (IP 66.150.161.147)
Public registrar record:

Profile

Domain age:
22 years and 27 days
Domain worth:
$39,692
Health score:
25.38%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #enameco.com

Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
domainname registration (18%), domain name (16%, $11.57), web address (5%, $4.63), online (4%, $3.19), calling cards (4%, $4.51)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

SERP organic visitors
This domain is found only in United States local organic SERPs.

SEO

Indexed pages:
3 (8)
Backwards:
350 (39)
Homepage links:
internal 0, external 11
Title history:
1 changes recorded
HTML validation:
Error
Title:
eNameCo Domain Name Registration - Register Your Domain Today!
Meta-keywords:
domainregistrationnameregisterwebsearchinternetservicesbuynewtransferregistrarservicecheckavailabilityinformationusnettopleveltvbuyingwholookupnomukregisteringpurchasedomain register domain lookup domain name web hosting web hosting website
Meta-description:
Domain registration and enterprise class domain management
Links from homepages:(detailed)
2 links (from 1 unique hosts)
Examples: domain-price-wars.com
Smartviper Domain RSS:
Get the latest updates on enameco.com via RSS
SERP organic visibility: based on research of 16,000,000 keywords
Domain name is seen on one search engine query. Position in SERP is 40. Statistical information was collected from April 21, 2012 to April 21, 2012
SERP organic rankings distribution:
Visualizes organic positions distribution for domain pages that were found in top 40 results.