MarkosWeb

covid-19 widget

devphp.sourceforge.net

Dev-PHP Website v3.0 and v2.0 - News

edit
Welcome to the Dev-PHP website - httpdevphp.sourceforge.net


Another popular subdomains are: lists.sourceforge.net, audacity.sourceforge.net, svn.sourceforge.net, gallery.sourceforge.net

Rating:
4.8 of 5 (4 votes)
Indexed pages:
18 (1)
Backwards:
1,582 (13)
Links from homepages:
5 links (from 3 hosts)
updated November 6, 2013
Homepage links:
internal 28, external 74
Snapshot history:
23 available via snapshot tool
HTML validation:
OK
DNS resolve:
OK
Domain worth:
$14,484
Health score:
34.73%

Technical

Website availability: (is site down?)
Used technologies:
Cache tools
Varnish
Operating systems
CentOS
Web servers
Apache (version 2.2.15)
Hosting:
SAVVIS (SourceForge, Inc.)
Hosting abuse phone:
office +1-877-386-3323
Hosting abuse mail:
Domain IP:
216.34.181.96 United States
DNS Resolve:
OK

Profile

Domain worth:
$14,484
Health score:
34.73%
Domain score widget:
Domain worth widget:
Smartviper certification:

Social #devphp.sourceforge.net

Social activity: updated 19 Oct 2013
Smartviper reviews:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
php website (18%, $0.79), php 3 (11%), php gtk (11%, $0.11), php 5 (11%, $1.51), compiler (6%, $1.81)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    18 (1)
    Backwards:
    1,582 (13)
    Homepage links:
    internal 28, external 74
    HTML validation:
    OK
    Title:
    Dev-PHP Website v3.0 and v2.0 - News
    Meta-keywords:
    devphpdev-phpphpdevidemysqlsqlscripthtmlcssparseropensourceeditoreditcompilerinterpreterwindowsjavascriptcgifreeopensourcecompilerxmlxhtmldhtmldebuggerxdebugftpsftp
    Meta-description:
    Welcome to the Dev-PHP website - httpdevphp.sourceforge.net
    Links from homepages:(detailed)
    5 links (from 3 unique hosts)
    Examples: free-php-editor.com, php.boogolinks.nl, osswin.sourceforge.net
    Smartviper Domain RSS:
    Get the latest updates on devphp.sourceforge.net via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 24 search engine queries. Average position in SERP is 23. Best position in SERP for this domain is #1 (it's found 2 times). Statistical information was collected from April 20, 2012 to April 23, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.