MarkosWeb

covid-19 widget

checkmd.com

Online Reputation Management Done Differently

edit
There's a lot of online reputation management companies out there. Our proactive approach focus on customer engagement and unique tools make us different


This website redirects to www.terillion.com

Rating:
4 of 5 (1 votes)
Indexed pages:
1 (6)
Backwards:
1,536 (114)
Links from homepages:
1 links (from 1 hosts)
updated November 6, 2013
Homepage links:
internal 23, external 12
Unique visitors:
436 ( 1,626)
diff as of January 1, 2013
Snapshot history:
19 available via snapshot tool
Title history:
1 changes recorded
HTML validation:
Error
Domain alerts:
Between 3:00:08 PM September 19, 2013 and 8:59:52 PM November 6, 2013 the our bot had 3 unsuccessful attempts to complete the IP address dns resolve of this domain.
DNS resolve:
False explanation
Domain worth:
$225,002
Health score:
37.29%

Technical

Website availability: (is site down?)
Hosting:
1&1 Internet (1&1 Internet Inc.)
Hosting abuse phone:
office +1-877-206-4253
Hosting abuse mail:
Domain IP:
74.208.126.24 United States (5 changes since July 6, 2009)
IP history:
November 13, 2012 74.208.112.99 → 74.208.126.24
January 13, 2012 74.208.246.154 → 74.208.112.99
February 3, 2011 74.208.246.158 → 74.208.246.154
January 21, 2010 74.208.170.42 → 74.208.246.158
July 6, 2009 72.3.135.185 (Rackspace.com) → 74.208.170.42(1&1 Internet)
DNS Resolve:
False explanation
Domain registrar:
1 & 1 INTERNET AG domain profile
Domains using same registrar:105,233
Name server (NS) records:
ns57.1and1.com (IP 217.160.82.168)
Other domains using this NS: 21,128
ns58.1and1.com (IP 217.160.83.168)
Other domains using this NS: 21,130
NS history:
1 changes since July 6, 2009
July 6, 2009 ns.rackspace.com
ns2.rackspace.com
ns57.1and1.com
ns58.1and1.com
Public registrar record:

Profile

Unique visitors:
436 ( 1,626)
diff as of January 1, 2013
Domain age:
20 years and 7 months
Domain alerts:
Between 3:00:08 PM September 19, 2013 and 8:59:52 PM November 6, 2013 the our bot had 3 unsuccessful attempts to complete the IP address dns resolve of this domain.
Domain worth:
$225,002
Health score:
37.29%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #checkmd.com

Social activity: updated 25 Feb 2014
MarkosWeb reviews:
Social Contacts:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
checkmd.com is not banned and allowed to display Adsense ads, first confirmation of allowed to display ads status date is 2014-01-18 05:24:02. The date of the most recent test confirming allowed status is 2014-01-18 05:24:02.
Tags prominence:
(important page elements, estimated advertising value)
health (13%, $3.65), care (13%, $2.85), health care (13%, $3.74), healthcare (7%, $3.17), doctor (7%, $1.25)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view

SEO

Indexed pages:
1 (6)
Backwards:
1,536 (114)
Homepage links:
internal 23, external 12
Title history:
1 changes recorded
HTML validation:
Error
Title:
Online Reputation Management Done Differently
Meta-keywords:
healthcaredoctordoctorshospitalratingsmedical licensedoctor reviewsphysiciansmalpracticemedical informationdoctor ratingshealth carehealthcarehealth informationhealth newshealthcare informationdrug information
Meta-description:
There's a lot of online reputation management companies out there. Our proactive approach focus on customer engagement and unique tools make us different
Links from homepages:(detailed)
1 links (from 1 unique hosts)
Examples: emeraldcoastpain.com
MarkosWeb Domain RSS:
Get the latest updates on checkmd.com via RSS
SERP organic visibility: based on research of 16,000,000 keywords
This website does not receive any organic traffic (based on our research of 16 million keywords conducted 21 April 2012)