MarkosWeb

covid-19 widget

bdvb.de

Bundesverband Deutscher Volks- und Betriebswirte e.V. - Willkommen

edit
Willkommen beim bdvb - das Netzwerk fr konomen



Rating:
4.6 of 5 (5 votes)
Indexed pages:
612 (8)
Backwards:
24,924 (94)
Links from homepages:
11 links (from 7 hosts)
updated November 6, 2013
Homepage links:
internal 35, external 11
Unique visitors:
395 ( 307)
diff as of January 1, 2013
Snapshot history:
27 available via snapshot tool
HTML validation:
OK
DNS resolve:
OK
Domain worth:
$45,027
Health score:
30.07%

Technical

Website availability: (is site down?)
Used technologies:
Font scripts
sIFR
Javascript frameworks
jQuery (version 1.10.2)
Prototype
Programming languages
PHP
Web servers
Apache
Hosting:
SpeedPartner GmbH (Bundesverband Deutscher Volks- und Betriebswirte e.V.)
Hosting admin phone:
+49-211-371022
Domain IP:
91.184.37.93 Germany (1 changes since October 25, 2009)
IP history:
October 25, 2009 217.79.220.187 (Equinix (Germany) GmbH) → 91.184.37.93(SpeedPartner GmbH)
DNS Resolve:
OK
NS history:
1 changes since October 25, 2009
February 13, 2011 ns1.twt.de
ns2.twt.de
ns1.dnspartner.de
ns2.dnspartner.de

Profile

Unique visitors:
395 ( 307)
diff as of January 1, 2013
Domain worth:
$45,027
Health score:
30.07%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #bdvb.de

Social activity: updated 19 Aug 2014
MarkosWeb reviews:
Social Contacts:

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
wirtschaft (7%, $1.04), gruppen (7%, $0.79), termine (7%, $0.69), leistungen (7%, $1.60), mitglied (7%, $0.63)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    612 (8)
    Backwards:
    24,924 (94)
    Homepage links:
    internal 35, external 11
    HTML validation:
    OK
    Title:
    Bundesverband Deutscher Volks- und Betriebswirte e.V. - Willkommen
    Meta-keywords:
    bdvbverbanddeutschlandwirtschaftsakademikerverbandnetzwerk fr konomenakademikerwirtschaftVWLBWLwirtschaftswochewiwoarbeitsrecht michael brgerleistungenmitgliedgruppenbdvb-gruppen bezirks-gruppenhochschul-gruppen fach-gruppen standesvertretungweiterbildung veranstaltungtermine veranstaltungskalenderseminare bdvb-newsnachrichtenjobberuf betriebswirtemitgliederbereich
    Meta-description:
    Willkommen beim bdvb - das Netzwerk fr konomen
    Links from homepages:(detailed)
    MarkosWeb Domain RSS:
    Get the latest updates on bdvb.de via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 30 search engine queries. Average position in SERP is 25. Best position in SERP for this domain is #2 (it's found 1 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.