MarkosWeb

covid-19 widget

atosworldline.com

Worldline - Home

edit
A leader in end-to-end services for critical electronic transactions Atos Worldline is specialized in electronic payment services services for financial markets as well as eServices for customers citizens and communities eCS


This website redirects to http://worldline.com/en/1/Home.html

Rating:
3.7 of 5 (3 votes)
Indexed pages:
211 (30)
Backwards:
2,635 (339)
Links from homepages:
5 links (from 4 hosts)
updated November 6, 2013
Homepage links:
internal 46, external 11
Unique visitors:
1,382 ( 10,149)
diff as of July 1, 2013
Snapshot history:
15 available via snapshot tool
Title history:
2 changes recorded
HTML validation:
OK
Duplicates:
Duplicates: with similar title: 2, with similar meta description: 1, with similar title: 1. Details
DNS resolve:
OK
Domain worth:
$235,937
Health score:
28.57%

Technical

Website availability: (is site down?)

Latest result: Website is UP

Latest test time and date: 11:49:11 AM November 5, 2013

Latest test duration: 1.382 seconds


Test results (detailed CURL answer)
HTML size: 20639 bytes
Url: http://worldline.com/en/1/Home.html
Content_type: text/html;charset=ISO-8859-1
Http_code: 200
Header_size: 1029
Request_size: 1170
Filetime: -1
Redirect_count: 4
Total_time: 1.379785
Namelookup_time: 1.4E-5
Connect_time: 1.7E-5
Pretransfer_time: 3.4E-5
Size_download: 20639
Speed_download: 14958
Download_content_length: 20639
Starttransfer_time: 0.189195
Redirect_time: 0.941905
Used technologies:
Analytics
Google Analytics
Javascript frameworks
jQuery (version 1.6)
Miscellaneous
SWFObject
Web servers
Apache
Hosting:
Atos Worldline SAS (Atos Worldline IPv4 Subnet)
Hosting admin phone:
+33 320 607 979
Hosting admin mail:
Domain IP:
160.92.140.242 France (1 changes since April 8, 2011)
IP history:
April 8, 2011 160.92.127.113 (Atos Worldline IPv4 Subnet) → 160.92.140.242(Atos Worldline SAS)
DNS Resolve:
OK
Domain registrar:
NETWORK SOLUTIONS, LLC. domain profile
Domains using same registrar:417,278
Name server (NS) records:
ns3.atos.net (IP 160.92.121.6)
Other domains using this NS: 83
ns4.atos.net (IP 193.56.46.248)
Other domains using this NS: 81
Public registrar record:

Profile

Unique visitors:
1,382 ( 10,149)
diff as of July 1, 2013
Domain age:
16 years and 11 months
Domain worth:
$235,937
Health score:
28.57%
Domain score widget:
Domain worth widget:
MarkosWeb certification:

Social #atosworldline.com

Social activity: updated 29 Jul 2014
MarkosWeb reviews:
Social Contacts:

Similar sites

Duplicates:
Website(s) with similar title: 2, with similar meta description: 1, with similar meta keywords: 1. Details
Associated domains:
Based on Google Analytics ID UA-6775504-1: 4 domains found, examples: atosworldline.fr, atosworldline.de, sips-atos.com, caraudiomall.co.kr

Advertising

AdSense Checker: (AdSense Checker:)
Is domain banned from using Google Adsense?
Tags prominence:
(important page elements, estimated advertising value)
add to favorites (18%), global site (9%, $1.55), electronic (8%, $2.27), services (7%, $3.69), market (6%, $3.16)
Ads SERP visibility: based on research of 16,000,000 keywords

Geography

Audience location:
Minimum required screen width is 768 - Please use other device to view
SERP organic visitors pie
Visualizes local performance of organic positions. Positions visibility distribution is presented by Country showing each country's share in %

    SEO

    Indexed pages:
    211 (30)
    Backwards:
    2,635 (339)
    Homepage links:
    internal 46, external 11
    Title history:
    2 changes recorded
    HTML validation:
    OK
    Title:
    Worldline - Home
    Meta-keywords:
    criticalelectronictransactionselectronicpaymentservicese-paymentepaymentservicesfinancial marketseServicescustomerscitizenscommunities
    Meta-description:
    A leader in end-to-end services for critical electronic transactions Atos Worldline is specialized in electronic payment services services for financial markets as well as eServices for customers citizens and communities eCS
    Links from homepages:(detailed)
    MarkosWeb Domain RSS:
    Get the latest updates on atosworldline.com via RSS
    SERP organic visibility: based on research of 16,000,000 keywords
    Domain name is seen on 29 search engine queries. Average position in SERP is 15. Best position in SERP for this domain is #1 (it's found 4 times). Statistical information was collected from April 20, 2012 to April 22, 2012
    SERP organic rankings distribution:
    Visualizes organic positions distribution for domain pages that were found in top 40 results.