SmartViper

Specialty Care websites probably the best selection from 55 total domains

Visitors who searched Specialty Care also search health care,  primary care,  find a doctor

Ophthalmology.ucdmc.ucdavis.edu - UC Davis Eye Center - Welcome

Tagged as: health care, health, california. See more tags (30) at ophthalmology.ucdmc.ucdavis.edu page.

http://www.ucdmc.ucdavis.edu/eyecenter/

Uofmhealth.org - UofMHealth homepage | University of Michigan Health System

Tagged as: health care, quality of life, health system. See more tags (11) at uofmhealth.org page.

http://www.uofmhealth.org/

Vcaspecialtyvets.com - Veterinarian Specialists | VCA Specialty Animal Hospitals

Tagged as: directory of, animal hospital, animal hospitals. See more tags (6) at vcaspecialtyvets.com page.

http://www.vcaspecialtyvets.com/

Healthcare.utah.edu - University of Utah Health Care | Salt Lake City, Utah

Tagged as: health care, k l m, health and wellness. See more tags (13) at healthcare.utah.edu page.

http://healthcare.utah.edu

Patientcarelink.org - PatientCareLink - Massachusetts Hospitals Continuing Commitment to Patient Safety and High-Quality Health Care

Tagged as: high quality, health care, in memoriam. See more tags (8) at patientcarelink.org page.

http://patientcarelink.org

Livewellnewyork.com - Live Well New York: A Health and Wellness Resource for New Yorkers

Tagged as: new york, new york city, york city. See more tags (11) at livewellnewyork.com page.

http://livewellnewyork.com/

Midwestipa.org - MIPA: Home - Find an independent doctor in Minnesota and Wisconsin

Tagged as: st louis, find a doctor, primary care. See more tags (7) at midwestipa.org page.

http://midwestipa.org

Khovnanianchildrenshospital.com Favicon Khovnanianchildrenshospital.com - Children's Hospital NJ | Children's Hospital New Jersey

Tagged as: new jersey, for children, find a physician. See more tags (6) at khovnanianchildrenshospital.com page.

http://www.khovnanianchildrenshospital.com/KHCH//

Myfirehouse.com - Firehouse Animal Health Center - Veterinarian In Austin, TX USA :: Home

Tagged as: near you, animal hospital, excellent service. See more tags (8) at myfirehouse.com page.

http://www.firehouseaustin.com

Mydh.org Favicon Mydh.org - myD-H | eD-H Electronic Health Record of Dartmouth-Hitchcock

Tagged as: get started, new users, activation code. See more tags (4) at mydh.org page.

http://mydh.org/

Chocshop.org Favicon Chocshop.org - CHOC Children's

Tagged as: orange county, programs and services. See more tags (3) at chocshop.org page.

http://chocshop.org

Vallettedosia.com Favicon Vallettedosia.com - :Accueil

Tagged as: for sale, los angeles, law firm. See more tags (30) at vallettedosia.com page.

http://vallettedosia.com

Takingthehelloutofhealthcare.com Favicon Takingthehelloutofhealthcare.com - Buy the Books » Healing Hospitals – Nick Jacobs, FACHE

Tagged as: health care, the power, mental health. See more tags (10) at takingthehelloutofhealthcare.com page.

http://takingthehelloutofhealthcare.com/blog/buy-the-book/

Lincolndocs.com - Lincoln's Specialty Care | Home

Tagged as: our mission, newsletter sign up, care home. See more tags (4) at lincolndocs.com page.

http://lincolndocs.com/

Giving.jhu.edu - Giving to Johns Hopkins

Tagged as: health care, long term, home care. See more tags (14) at giving.jhu.edu page.

http://giving.jhu.edu

Adventisthomecare.com - Adventist Home Care Services | At Home Health Care, In-Home Nurses & Caregivers for Seniors | Maryland (MD) & Washington, DC - Adventist Home Care Services

Tagged as: k l m, home care, medical care. See more tags (7) at adventisthomecare.com page.

http://www.adventisthomecare.com/AHCS/

Trilliumgiving.ca - THPF Home Page - Trillium Health Partners Foundation

Tagged as: latest news, support, in memory. See more tags (10) at trilliumgiving.ca page.

http://trilliumgiving.ca

Thecottagesofalb.com - New Mexico Alzheimer's and Dementia Care | The Cottages of Albuquerque

Tagged as: new mexico, dementia care, alzheimer's and dementia. See more tags (4) at thecottagesofalb.com page.

http://thecottagesofalb.com/index2.html

Whitingcare.com - Post Acute, Subacute Rehabilitation and Nursing Home Care, Whiting, NJ AristaCare at Whiting

Tagged as: home care, nursing home, wound care. See more tags (10) at whitingcare.com page.

http://whitingcare.com

Wsufamilycare.com - Detroit Centers for Family Medicine, southeast Michigan Family Medicine | Wayne State University Physician Group

Tagged as: health care, state university, care services. See more tags (14) at wsufamilycare.com page.

http://wsufamilycare.com

Vcaneshaminy.com - Veterinarians in Oakford, PA | VCA Neshaminy Animal Hospital

Tagged as: near you, animal hospital, business hours. See more tags (8) at vcaneshaminy.com page.

http://www.vcahospitals.com/neshaminy

Valleycareipa.com - Valley Care IPA ~ Serving Ventura, Santa Paula and Fillmore cities in Ventura County, California

Tagged as: health, california, physician. See more tags (23) at valleycareipa.com page.

http://valleycareipa.com

Txorthopaedic.com - Texas Orthopaedic Associates

Tagged as: u s, latest news, award winning. See more tags (10) at txorthopaedic.com page.

http://www.txorthopaedic.com/

Twotwelvemedical.org - Two Twelve Medical Center | Right Care, Right Now, Right Here

Tagged as: 24 hour, medical center, urgent care. See more tags (4) at twotwelvemedical.org page.

http://www.twotwelvemedical.org/

Uapclinic.com - Home - UAP Clinic - Terre Haute, Indiana

Tagged as: indiana, surgery, find a doctor. See more tags (30) at uapclinic.com page.

http://uapclinic.com

Wearepremierhealthcare.com - Premier Healthcare - Home

Tagged as: primary care, health plans, care providers. See more tags (7) at wearepremierhealthcare.com page.

http://wearepremierhealthcare.com

Olympicmedical.org - Welcome to Olympic Medical Center

Tagged as: technology, wellness, support. See more tags (30) at olympicmedical.org page.

http://olympicmedical.org

Midwesteyecare.com - Midwest Eye Care

Tagged as: eye care, vision care, eye disease. See more tags (5) at midwesteyecare.com page.

http://midwesteyecare.com/

Myharmonhousecarecenter.com - Skilled Nursing Centers in Mount Pleasant, PA - Personal Care Homes in Mount Pleasant, PA - Retirement Homes in Mount Pleasant, PA - Harmon House Care Center

Tagged as: pennsylvania, personal care, day care. See more tags (19) at myharmonhousecarecenter.com page.

http://myharmonhousecarecenter.com

Mysignaturecare.org - Signature Healthcare | Signature Healthcare

Tagged as: medical services. See more tags (2) at mysignaturecare.org page.

http://mysignaturecare.org/Main/Home.aspx

Poconoveter.com - Poconos Vet | Vet in the Poconos | Veterinarian Poconos

Tagged as: high quality, our mission. See more tags (3) at poconoveter.com page.

http://poconoveter.com

Preferredhomecareplus.com - Preferred Homecare Plus: Providing priority care is out Preference

Tagged as: companion care, homecare agency. See more tags (3) at preferredhomecareplus.com page.

http://preferredhomecareplus.com

Tannerclinic.com - Tanner Clinic | When You Feel Good, We Feel Good

Tagged as: medical clinic, feel good. See more tags (3) at tannerclinic.com page.

http://tannerclinic.com

Hemophiliaregion9.org - Hemophilia Region IX

Tagged as: health care, cost effective, medical care. See more tags (10) at hemophiliaregion9.org page.

http://hemophiliaregion9.org/

Kishhealthfamilyandspecialtycare.com - kishhealthfamilyandspecialtycare.com

Tagged as: northern illinois, dekalb county, medical centers. See more tags (6) at kishhealthfamilyandspecialtycare.com page.

http://kishhealthfamilyandspecialtycare.com/

Glowhealthcare.com - Home Page

Tagged as: alternative medicine, chiropractic, acupuncture. See more tags (13) at glowhealthcare.com page.

http://glowhealthcare.com/

Lincolnecdev.com - LPED | Home

Tagged as: information technology, chamber of commerce, higher education. See more tags (29) at lincolnecdev.com page.

http://www.selectlincoln.org/

Healthoneclinics.com - Leaders in physician specialty clinics and services in the Greater Denver area. - HealthOne Physician Care | Glendale, CO

Tagged as: sports, wellness, cost effective. See more tags (23) at healthoneclinics.com page.

http://healthoneclinics.com/

Mnwcare.com - Minnesota Women's Care :: Home

Tagged as: health care, infertility, menopause. See more tags (13) at mnwcare.com page.

http://mnwcare.com

Gi.ucsf.edu Favicon Gi.ucsf.edu - UCSF Dept of Medicine | Division of Gastroenterology | Welcome!

Tagged as: contact information, the program, training programs. See more tags (9) at gi.ucsf.edu page.

http://gi.ucsf.edu

Ghcscw.com - Group Health Cooperative of South Central Wisconsin (GHC-SCW) - Health Insurance

Tagged as: u s, health care, health insurance. See more tags (14) at ghcscw.com page.

http://ghcscw.com/

Ghcmychart.com - Group Health Cooperative of South Central Wisconsin (GHC-SCW) - Health Insurance

Tagged as: health care, health insurance, classes. See more tags (14) at ghcmychart.com page.

http://ghcmychart.com/

Uwhpwatertown.com - Regional Medical Center Hospital and Clinics | UW Health Partners - Watertown, WI | UW Watertown Regional Medical Center

Tagged as: for children, medical center, find a doctor. See more tags (6) at uwhpwatertown.com page.

http://www.uwhpwatertown.com/Main/Home.aspx

Totallongtermcare.org - InnovAge: Affordable, In-Home Senior Care in Colorado

Tagged as: health care, to speak, home care. See more tags (8) at totallongtermcare.org page.

http://totallongtermcare.org

Supportingsaferhealthcare.com - Supporting Safer Healthcare | News and Resources for Healthcare Management

Tagged as: u s, in the uk, vitamin c. See more tags (8) at supportingsaferhealthcare.com page.

http://www.supportingsaferhealthcare.com/

Specialty-care.com - Welcome to Specialty Care & Specialty Living

Tagged as: management system, joomla, content management system. See more tags (7) at specialty-care.com page.

http://specialty-care.com

Specialty-care.net - specialty-care.net domain for sale for bright vision and more traffic

Tagged as: for sale, special offers, e business. See more tags (13) at specialty-care.net page.

http://specialty-care.net

Ghv.com - Omnicare : Home

Tagged as: our mission, long term, assisted living. See more tags (12) at ghv.com page.

http://www.omnicare.com/

Newtownvets.com

Tagged as: new england, 24 hour, animal hospital. See more tags (5) at newtownvets.com page.

http://www.newtownvets.com/

Searches related to: specialty care

What people search with specialty care:

more...